RAB14 Antibody - #DF12460
Product: | RAB14 Antibody |
Catalog: | DF12460 |
Description: | Rabbit polyclonal antibody to RAB14 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 24 kDa; 24kD(Calculated). |
Uniprot: | P61106 |
RRID: | AB_2845265 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12460, RRID:AB_2845265.
Fold/Unfold
bA165P4.3; F protein binding protein 1; FBP; GTPase Rab14; RAB 14; RAB14; RAB14 member RAS oncogene family; RAB14_HUMAN; Ras related protein Rab 14; Ras-related protein Rab-14; RP11 165P4.4; Small GTP binding protein RAB14;
Immunogens
- P61106 RAB14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61106 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
Y8 | Phosphorylation | Uniprot | |
Y14 | Phosphorylation | Uniprot | |
C26 | S-Nitrosylation | Uniprot | |
K34 | Ubiquitination | Uniprot | |
K35 | Ubiquitination | Uniprot | |
S56 | Phosphorylation | Uniprot | |
K59 | Ubiquitination | Uniprot | |
K61 | Ubiquitination | Uniprot | |
T67 | Phosphorylation | Uniprot | |
Y80 | Phosphorylation | Uniprot | |
Y81 | Phosphorylation | Uniprot | |
Y91 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
Y99 | Phosphorylation | Uniprot | |
S103 | Phosphorylation | Uniprot | |
T107 | Phosphorylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K140 | Ubiquitination | Uniprot | |
K156 | Ubiquitination | Uniprot | |
K170 | Ubiquitination | Uniprot | |
K171 | Ubiquitination | Uniprot | |
S180 | Phosphorylation | Uniprot | |
K193 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity). Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion.
Recycling endosome. Early endosome membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus>trans-Golgi network membrane>Lipid-anchor>Cytoplasmic side. Cytoplasmic vesicle>Phagosome.
Note: Recruited to recycling endosomes by DENND6A (PubMed:22595670). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211).
Interacts with KIF16B (By similarity). Interacts with ZFYVE20.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.