PDHX Antibody - #DF12448
Product: | PDHX Antibody |
Catalog: | DF12448 |
Description: | Rabbit polyclonal antibody to PDHX |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 54 kDa; 54kD(Calculated). |
Uniprot: | O00330 |
RRID: | AB_2845253 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12448, RRID:AB_2845253.
Fold/Unfold
Dihydrolipoamide dehydrogenase binding protein of pyruvate dehydrogenase complex; Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; DLDBP; E3 binding protein; E3-binding protein; E3BP; Lipoyl containing pyruvate dehydrogenase complex component X; Lipoyl-containing pyruvate dehydrogenase complex component X; mitochondrial; ODPX_HUMAN; OPDX; PDHX; PDX 1; PDX1; Pro X; proX; Pyruvate dehydrogenase complex component X; Pyruvate dehydrogenase complex lipoyl containing component X; Pyruvate dehydrogenase complex, E3 binding protein subunit; Pyruvate dehydrogenase protein X component; Pyruvate dehydrogenase protein X component mitochondrial;
Immunogens
- O00330 ODPX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00330 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y16 | Phosphorylation | Uniprot | |
S25 | Phosphorylation | Uniprot | |
S65 | Phosphorylation | Uniprot | |
K79 | Ubiquitination | Uniprot | |
T95 | Phosphorylation | Uniprot | |
T101 | Phosphorylation | Uniprot | |
K120 | Acetylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
S154 | Phosphorylation | Uniprot | |
S162 | Phosphorylation | Uniprot | |
S168 | Phosphorylation | Uniprot | |
K173 | Ubiquitination | Uniprot | |
T179 | Phosphorylation | Uniprot | |
K194 | Acetylation | Uniprot | |
S196 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot | |
R208 | Methylation | Uniprot | |
K213 | Ubiquitination | Uniprot | |
K223 | Ubiquitination | Uniprot | |
K314 | Ubiquitination | Uniprot | |
S364 | Phosphorylation | Uniprot | |
T369 | Phosphorylation | Uniprot | |
T375 | Phosphorylation | Uniprot | |
K384 | Ubiquitination | Uniprot | |
K394 | Ubiquitination | Uniprot | |
K460 | Ubiquitination | Uniprot | |
K488 | Acetylation | Uniprot | |
K491 | Acetylation | Uniprot | |
K491 | Methylation | Uniprot |
Research Backgrounds
Required for anchoring dihydrolipoamide dehydrogenase (E3) to the dihydrolipoamide transacetylase (E2) core of the pyruvate dehydrogenase complexes of eukaryotes. This specific binding is essential for a functional PDH complex.
Delipoylated at Lys-97 by SIRT4, delipoylation decreases the PHD complex activity.
Mitochondrion matrix.
Part of the inner core of the multimeric pyruvate dehydrogenase complex that is composed of about 48 DLAT and 12 PDHX molecules. This core binds multiple copies of pyruvate dehydrogenase (subunits PDH1A and PDHB, E1), dihydrolipoamide acetyltransferase (DLAT, E2) and lipoamide dehydrogenase (DLD, E3). Interacts with SIRT4. Interacts with DLD.
Belongs to the 2-oxoacid dehydrogenase family.
Research Fields
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.