EIF2B1 Antibody - #DF12392
| Product: | EIF2B1 Antibody |
| Catalog: | DF12392 |
| Description: | Rabbit polyclonal antibody to EIF2B1 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 34 kDa; 34kD(Calculated). |
| Uniprot: | Q14232 |
| RRID: | AB_2845197 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12392, RRID:AB_2845197.
Fold/Unfold
EI2BA_HUMAN; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; Eif2b1; EIF2BA; Eukaryotic translation initiation factor 2B subunit 1 alpha 26kDa; Eukaryotic translation initiation factor 2B subunit alpha; Translation initiation factor eIF-2B subunit alpha;
Immunogens
- Q14232 EI2BA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14232 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K11 | Ubiquitination | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| T29 | Phosphorylation | Uniprot | |
| K35 | Acetylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| Y83 | Phosphorylation | Uniprot | |
| S84 | Phosphorylation | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot | |
| Y130 | Phosphorylation | Uniprot | |
| K145 | Methylation | Uniprot | |
| K145 | Ubiquitination | Uniprot | |
| S149 | Phosphorylation | Uniprot | |
| K163 | Acetylation | Uniprot | |
| K253 | Ubiquitination | Uniprot | |
| K258 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Complex of five different subunits; alpha, beta, gamma, delta and epsilon.
Belongs to the eIF-2B alpha/beta/delta subunits family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.