EGFL7 Antibody - #DF12391
| Product: | EGFL7 Antibody |
| Catalog: | DF12391 |
| Description: | Rabbit polyclonal antibody to EGFL7 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Dog, Chicken |
| Mol.Wt.: | 41-45 kDa; 30kD(Calculated). |
| Uniprot: | Q9UHF1 |
| RRID: | AB_2845196 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12391, RRID:AB_2845196.
Fold/Unfold
EGF like domain 7; EGF like domain containing protein 7; EGF like domain multiple 7; EGF-like protein 7; EGFL 7; EGFL7; EGFL7_HUMAN; Epidermal growth factor like domain protein 7; Epidermal growth factor-like protein 7; MEGF 7; MEGF7; MGC111117; Multiple EGF like domain protein 7; Multiple EGF-like domains protein 7; Multiple epidermal growth factor like domain protein 7; Multiple epidermal growth factor-like domains protein 7; NEU1; NEU1 protein; NOTCH4 like protein; NOTCH4-like protein; RP11 251M1.2; UNQ187/PRO1449; Vascular endothelial statin; VE statin; VE-statin; ZNEU 1; ZNEU1;
Immunogens
- Q9UHF1 EGFL7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UHF1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y49 | Phosphorylation | Uniprot | |
| T54 | O-Glycosylation | Uniprot | |
| T54 | Phosphorylation | Uniprot | |
| T55 | O-Glycosylation | Uniprot | |
| Y65 | Phosphorylation | Uniprot | |
| K93 | Ubiquitination | Uniprot | |
| T190 | O-Glycosylation | Uniprot | |
| K197 | Ubiquitination | Uniprot |
Research Backgrounds
Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.
Secreted>Extracellular space.
Interacts with ITGAV/ITGB3 in an RGD-dependent manner, increasing endothelial cell's motility.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.