CRLS1 Antibody - #DF12373
| Product: | CRLS1 Antibody |
| Catalog: | DF12373 |
| Description: | Rabbit polyclonal antibody to CRLS1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 50 kDa; 33kD(Calculated). |
| Uniprot: | Q9UJA2 |
| RRID: | AB_2845178 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12373, RRID:AB_2845178.
Fold/Unfold
0610009I22Rik; 4930557M15Rik; 5730490M08; C20orf155; Cardiolipin synthase 1; Cardiolipin synthase; CLS; CLS1; CRLS1; CRLS1_HUMAN; dJ967N21.6; GCD10; OTTMUSP00000016677; Protein GCD10 homolog; RGD1311037; RP23-77H16.4;
Immunogens
A synthesized peptide derived from human CRLS1, corresponding to a region within the internal amino acids.
- Q9UJA2 CRLS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions.
Mitochondrion inner membrane>Multi-pass membrane protein.
Highly expressed in tissues such as heart, skeletal muscle and liver.
Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
Research Fields
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.