CPLX2 Antibody - #DF12370
| Product: | CPLX2 Antibody |
| Catalog: | DF12370 |
| Description: | Rabbit polyclonal antibody to CPLX2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken |
| Mol.Wt.: | 18-20 kDa; 15kD(Calculated). |
| Uniprot: | Q6PUV4 |
| RRID: | AB_2845175 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12370, RRID:AB_2845175.
Fold/Unfold
921 L; Complexin 2; Complexin II; Complexin-2; Complexin2; ComplexinII; CPLX 2; Cplx2; CPLX2_HUMAN; CPX 2; CPX II; CPXII; Hfb1; Synaphin 1; Synaphin-1; Synaphin1;
Immunogens
Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia.
- Q6PUV4 CPLX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q6PUV4 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K14 | Acetylation | Uniprot | |
| Y70 | Phosphorylation | Uniprot | |
| S93 | Phosphorylation | Uniprot |
Research Backgrounds
Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles. Also involved in mast cell exocytosis (By similarity).
Cytoplasm>Cytosol. Cell junction>Synapse>Presynapse. Nucleus. Perikaryon.
Note: Translocated from the perikaryon to the presynaptic terminals during maturation of neuronal cells. In mast cells, cytosol and nucleus. Becomes enriched near plasma membrane following stimulation.
Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia.
Binds to the SNARE core complex containing SNAP25, VAMP2 and STX1A.
Belongs to the complexin/synaphin family.
Research Fields
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.