COLEC11 Antibody - #DF12368
Product: | COLEC11 Antibody |
Catalog: | DF12368 |
Description: | Rabbit polyclonal antibody to COLEC11 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Zebrafish |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 34 kDa; 29kD(Calculated). |
Uniprot: | Q9BWP8 |
RRID: | AB_2845173 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12368, RRID:AB_2845173.
Fold/Unfold
CL K1; CL K1 I; CL K1 II; CL K1 IIa; CL K1 IIb; CL-K1; CLK1; COL11_HUMAN; COLEC 11; COLEC11; Collectin 11; Collectin kidney I; Collectin kidney protein 1; Collectin sub family member 11; Collectin-11; Collectin11; DKFZp686N1868; MGC129470; MGC129471; MGC3279;
Immunogens
Ubiquitous (PubMed:17179669). Detected in adrenal gland, kidney, liver, ovaries and testis (at protein level) (PubMed:20956340).
- Q9BWP8 COL11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BWP8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S13 | Phosphorylation | Uniprot | |
S18 | Phosphorylation | Uniprot | |
T133 | Phosphorylation | Uniprot | |
S134 | Phosphorylation | Uniprot |
Research Backgrounds
Lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding (Probable). Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis.
Secreted.
Ubiquitous. Detected in adrenal gland, kidney, liver, ovaries and testis (at protein level).
Homotrimer; disulfide-linked. Interacts with MASP1; probably triggers the lectin pathway of complement.
Belongs to the COLEC10/COLEC11 family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.