CCBL1/KAT1 Antibody - #DF12361
| Product: | CCBL1/KAT1 Antibody |
| Catalog: | DF12361 |
| Description: | Rabbit polyclonal antibody to CCBL1/KAT1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 48-50 kDa; 48kD(Calculated). |
| Uniprot: | Q16773 |
| RRID: | AB_2845166 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12361, RRID:AB_2845166.
Fold/Unfold
Beta lyase; Beta lysase, kidney; CCBL 1; Cysteine conjugate beta lyase; Cysteine conjugate beta lyase, cytoplasmic; Cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); Cysteine S conjugate beta lyase; Cytoplasmic cysteine conjugate beta lyase; FLJ95217; Glutamine phenylpyruvate aminotransferase; Glutamine transaminase K; GTK; KAT1; KATI; Kyneurenine aminotransferase; Kynurenine aminotransferase I; Kynurenine oxoglutarate transaminase 1; MGC29624; OTTHUMP00000022311; OTTHUMP00000022312;
Immunogens
- Q16773 KAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16773 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K3 | Ubiquitination | Uniprot | |
| Y15 | Phosphorylation | Uniprot | |
| T172 | Phosphorylation | Uniprot | |
| K176 | Ubiquitination | Uniprot | |
| T182 | Phosphorylation | Uniprot | |
| K247 | Ubiquitination | Uniprot | |
| K414 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond.
Cytoplasm.
Homodimer.
Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
Research Fields
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Metabolism > Amino acid metabolism > Tryptophan metabolism.
· Metabolism > Metabolism of other amino acids > Selenocompound metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.