BAMBI Antibody - #DF12355
| Product: | BAMBI Antibody |
| Catalog: | DF12355 |
| Description: | Rabbit polyclonal antibody to BAMBI |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 55 kDa; 29kD(Calculated). |
| Uniprot: | Q13145 |
| RRID: | AB_2845160 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12355, RRID:AB_2845160.
Fold/Unfold
BAMBI; BAMBI_HUMAN; BMP and activin membrane bound inhibitor homolog; BMP and activin membrane-bound inhibitor homolog; NMA; Non metastatic gene A protein; Non-metastatic gene A protein; Putative transmembrane protein NMA;
Immunogens
High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
- Q13145 BAMBI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q13145 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y31 | Phosphorylation | Uniprot | |
| T40 | Phosphorylation | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| S114 | O-Glycosylation | Uniprot | |
| K146 | Ubiquitination | Uniprot | |
| Y196 | Phosphorylation | Uniprot | |
| K231 | Sumoylation | Uniprot | |
| K241 | Sumoylation | Uniprot | |
| K241 | Ubiquitination | Uniprot | |
| Y251 | Phosphorylation | Uniprot |
Research Backgrounds
Negatively regulates TGF-beta signaling.
Membrane>Single-pass type I membrane protein.
High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested.
Belongs to the BAMBI family.
Research Fields
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.