ARL8B Antibody - #DF12350

Product: | ARL8B Antibody |
Catalog: | DF12350 |
Description: | Rabbit polyclonal antibody to ARL8B |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 22 kDa; 22kD(Calculated). |
Uniprot: | Q9NVJ2 |
RRID: | AB_2845155 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12350, RRID:AB_2845155.
Fold/Unfold
ADP ribosylation factor like 10C; ADP-ribosylation factor-like protein 10C; ADP-ribosylation factor-like protein 8B; ARL10C; ARL8B; ARL8B_HUMAN; FLJ10702; Gie1; Novel small G protein indispensable for equal chromosome segregation 1;
Immunogens
- Q9NVJ2 ARL8B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NVJ2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T61 | Phosphorylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K68 | Ubiquitination | Uniprot | |
S107 | Phosphorylation | Uniprot | |
K117 | Ubiquitination | Uniprot | |
K141 | Sumoylation | Uniprot | |
K141 | Ubiquitination | Uniprot | |
K146 | Ubiquitination | Uniprot | |
K182 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a role in lysosome motility. In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation.
Late endosome membrane. Lysosome membrane. Cytoplasm>Cytoskeleton>Spindle. Cell projection>Axon. Cell junction>Synapse.
Note: Localizes with microtubules at the spindle mid-zone during mitosis.
Ubiquitously expressed.
Interacts with tubulin Ref.16). Interacts with BORCS5; recruits ARL8B to lysosomes.
Belongs to the small GTPase superfamily. Arf family.
References
Application: WB Species: Mouse Sample:
Application: IF/ICC Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.