ARHGDIB Antibody - #DF12349
Product: | ARHGDIB Antibody |
Catalog: | DF12349 |
Description: | Rabbit polyclonal antibody to ARHGDIB |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 27 kDa; 23kD(Calculated). |
Uniprot: | P52566 |
RRID: | AB_2845154 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12349, RRID:AB_2845154.
Fold/Unfold
Arhgdib; D4; D4 GDP dissociation inhibitor; GDIA 2; GDIA2; GDID 4; GDID4; GDIR2_HUMAN; GDP dissociation inhibitor D4; LY GDI; Ly-GDI; LYGDI; MGC108926; RAP1GN1; Rho GDI 2; Rho GDI beta; Rho GDI2; Rho GDP dissociation inhibitor (GDI) beta; Rho GDP dissociation inhibitor 2; Rho GDP dissociation inhibitor beta; Rho GDP-dissociation inhibitor 2; Rho-GDI beta; RhoGDI2;
Immunogens
- P52566 GDIR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P52566 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K4 | Acetylation | Uniprot | |
K4 | Ubiquitination | Uniprot | |
S20 | Phosphorylation | Uniprot | |
K21 | Acetylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
Y24 | Phosphorylation | P12931 (SRC) , P43405 (SYK) | Uniprot |
K25 | Acetylation | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K30 | Acetylation | Uniprot | |
K30 | Ubiquitination | Uniprot | |
S31 | Phosphorylation | P17252 (PRKCA) | Uniprot |
K33 | Acetylation | Uniprot | |
K33 | Ubiquitination | Uniprot | |
K40 | Acetylation | Uniprot | |
K40 | Ubiquitination | Uniprot | |
S44 | Phosphorylation | Uniprot | |
K47 | Acetylation | Uniprot | |
K47 | Ubiquitination | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
T51 | Phosphorylation | Uniprot | |
T60 | Phosphorylation | Uniprot | |
K63 | Acetylation | Uniprot | |
K63 | Ubiquitination | Uniprot | |
C76 | S-Nitrosylation | Uniprot | |
S78 | Phosphorylation | Uniprot | |
K95 | Acetylation | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K96 | Ubiquitination | Uniprot | |
K102 | Acetylation | Uniprot | |
K102 | Ubiquitination | Uniprot | |
K110 | Ubiquitination | Uniprot | |
K114 | Ubiquitination | Uniprot | |
K124 | Acetylation | Uniprot | |
K124 | Ubiquitination | Uniprot | |
Y130 | Phosphorylation | Uniprot | |
K135 | Acetylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K138 | Acetylation | Uniprot | |
K138 | Ubiquitination | Uniprot | |
S145 | Phosphorylation | Uniprot | |
Y146 | Phosphorylation | Uniprot | |
Y153 | Phosphorylation | P12931 (SRC) | Uniprot |
T157 | Phosphorylation | Uniprot | |
K164 | Ubiquitination | Uniprot | |
K175 | Acetylation | Uniprot | |
K175 | Ubiquitination | Uniprot | |
T179 | Phosphorylation | Uniprot | |
S194 | Phosphorylation | Uniprot | |
K197 | Acetylation | Uniprot |
Research Backgrounds
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Regulates reorganization of the actin cytoskeleton mediated by Rho family members.
Cytoplasm>Cytosol.
Detected in bone marrow, thymus and spleen.
Interacts with RHOA. Interacts with RAC1. Interacts with RAC2. Interacts with CDC42.
Belongs to the Rho GDI family.
Research Fields
· Organismal Systems > Nervous system > Neurotrophin signaling pathway. (View pathway)
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.