ACAA1 Antibody - #DF12345
Product: | ACAA1 Antibody |
Catalog: | DF12345 |
Description: | Rabbit polyclonal antibody to ACAA1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 41 kDa; 44kD(Calculated). |
Uniprot: | P09110 |
RRID: | AB_2845150 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12345, RRID:AB_2845150.
Fold/Unfold
3 ketoacyl CoA thiolase peroxisomal; 3-ketoacyl-CoA thiolase; ACAA; ACAA1; Acetyl CoA acyltransferase 1; Acetyl Coenzyme A acyltransferase 1; Acetyl-CoA acyltransferase; Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A; Beta ketothiolase; Beta-ketothiolase; Peroxisomal 3 oxoacyl CoA thiolase; Peroxisomal 3 oxoacyl Coenzyme A thiolase; Peroxisomal 3-oxoacyl-CoA thiolase; peroxisomal; PTHIO; THIK_HUMAN; THIO;
Immunogens
- P09110 THIK_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09110 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T59 | Phosphorylation | Uniprot | |
T60 | Phosphorylation | Uniprot | |
T70 | Phosphorylation | Uniprot | |
S124 | Phosphorylation | Uniprot | |
S125 | Phosphorylation | Uniprot | |
S132 | Phosphorylation | Uniprot | |
S141 | Phosphorylation | Uniprot | |
S166 | Phosphorylation | Uniprot | |
K198 | Acetylation | Uniprot | |
K198 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot | |
K234 | Acetylation | Uniprot | |
K237 | Acetylation | Uniprot | |
S251 | Phosphorylation | Uniprot | |
T252 | Phosphorylation | Uniprot | |
K259 | Acetylation | Uniprot | |
S269 | Phosphorylation | Uniprot | |
S291 | Phosphorylation | Uniprot | |
K292 | Ubiquitination | Uniprot | |
Y323 | Phosphorylation | Uniprot | |
S337 | Phosphorylation | Uniprot | |
T389 | Phosphorylation | Uniprot | |
K395 | Acetylation | Uniprot |
Research Backgrounds
Peroxisome.
Homodimer.
Belongs to the thiolase-like superfamily. Thiolase family.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
· Metabolism > Lipid metabolism > Fatty acid degradation.
· Metabolism > Amino acid metabolism > Valine, leucine and isoleucine degradation.
· Metabolism > Lipid metabolism > alpha-Linolenic acid metabolism.
· Metabolism > Lipid metabolism > Biosynthesis of unsaturated fatty acids.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Fatty acid metabolism.
· Organismal Systems > Endocrine system > PPAR signaling pathway.
References
Application: WB Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.