UQCRC2 Antibody - #DF12339
Product: | UQCRC2 Antibody |
Catalog: | DF12339 |
Description: | Rabbit polyclonal antibody to UQCRC2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 48 kDa; 48kD(Calculated). |
Uniprot: | P22695 |
RRID: | AB_2845144 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12339, RRID:AB_2845144.
Fold/Unfold
Complex III subunit 2; Core protein II; Cytochrome b c1 complex subunit 2 mitochondrial; Cytochrome b-c1 complex subunit 2; EC 1.10.2.2; MC3DN5; mitochondrial; QCR2; QCR2_HUMAN; Ubiquinol cytochrome c reductase complex core protein 2 mitochondrial; Ubiquinol cytochrome c reductase core protein II; Ubiquinol-cytochrome-c reductase complex core protein 2; UQCR2; Uqcrc2;
Immunogens
- P22695 QCR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P22695 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K17 | Ubiquitination | Uniprot | |
K23 | Ubiquitination | Uniprot | |
Y55 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
S59 | Phosphorylation | Uniprot | |
K66 | Acetylation | Uniprot | |
T86 | Phosphorylation | Uniprot | |
T91 | Phosphorylation | Uniprot | |
K92 | Ubiquitination | Uniprot | |
K98 | Methylation | Uniprot | |
K98 | Ubiquitination | Uniprot | |
T100 | Phosphorylation | Uniprot | |
S111 | Phosphorylation | Uniprot | |
T113 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
Y182 | Phosphorylation | Uniprot | |
Y191 | Phosphorylation | Uniprot | |
K199 | Ubiquitination | Uniprot | |
Y207 | Phosphorylation | Uniprot | |
S226 | Phosphorylation | Uniprot | |
R241 | Methylation | Uniprot | |
K250 | Ubiquitination | Uniprot | |
R254 | Methylation | Uniprot | |
R301 | Methylation | Uniprot | |
K359 | Ubiquitination | Uniprot | |
S367 | Phosphorylation | Uniprot | |
T369 | Phosphorylation | Uniprot | |
K375 | Ubiquitination | Uniprot | |
K429 | Acetylation | Uniprot | |
K436 | Ubiquitination | Uniprot | |
T447 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c (By similarity). The 2 core subunits UQCRC1/QCR1 and UQCRC2/QCR2 are homologous to the 2 mitochondrial-processing peptidase (MPP) subunits beta-MPP and alpha-MPP respectively, and they seem to have preserved their MPP processing properties (By similarity). May be involved in the in situ processing of UQCRFS1 into the mature Rieske protein and its mitochondrial targeting sequence (MTS)/subunit 9 when incorporated into complex III (Probable).
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), a multisubunit enzyme composed of 11 subunits. The complex is composed of 3 respiratory subunits cytochrome b, cytochrome c1 and Rieske protein UQCRFS1, 2 core protein subunits UQCRC1/QCR1 and UQCRC2/QCR2, and 6 low-molecular weight protein subunits UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and subunit 9, the cleavage product of Rieske protein UQCRFS1 (By similarity). The complex exists as an obligatory dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with NADH-ubiquinone oxidoreductase (complex I, CI) and cytochrome c oxidase (complex IV, CIV), resulting in different assemblies (supercomplex SCI(1)III(2)IV(1) and megacomplex MCI(2)III(2)IV(2)). Interacts with RAB5IF.
Belongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.