TMSB4X Antibody - #DF12334
Product: | TMSB4X Antibody |
Catalog: | DF12334 |
Description: | Rabbit polyclonal antibody to TMSB4X |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Chicken, Xenopus |
Mol.Wt.: | 5 kDa; 5kD(Calculated). |
Uniprot: | P62328 |
RRID: | AB_2845139 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12334, RRID:AB_2845139.
Fold/Unfold
Fx; Hematopoietic system regulatory peptide; Prothymosin beta 4; PTMB 4; PTMB4; Seraspenide; T beta 4; T beta-4; TB4X; THYB 4; Thyb4; Thymosin beta 4; Thymosin beta 4 X chromosome; Thymosin beta 4 X linked; TMSB 4; TMSB4; Tmsb4x; TYB4_HUMAN;
Immunogens
Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
- P62328 TYB4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62328 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | Uniprot | |
K4 | Acetylation | Uniprot | |
K4 | Methylation | Uniprot | |
K4 | Ubiquitination | Uniprot | |
K12 | Acetylation | Uniprot | |
K12 | Ubiquitination | Uniprot | |
K15 | Acetylation | Uniprot | |
S16 | Phosphorylation | Uniprot | |
K17 | Acetylation | Uniprot | |
K20 | Ubiquitination | Uniprot | |
T21 | Phosphorylation | Uniprot | |
T23 | Phosphorylation | Uniprot | |
K26 | Acetylation | Uniprot | |
K26 | Ubiquitination | Uniprot | |
S31 | Phosphorylation | Uniprot | |
K32 | Acetylation | Uniprot | |
K32 | Ubiquitination | Uniprot | |
T34 | Phosphorylation | Uniprot | |
K39 | Acetylation | Uniprot | |
K39 | Ubiquitination | Uniprot | |
S44 | Phosphorylation | Uniprot |
Research Backgrounds
Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase.
Cytoplasm>Cytoskeleton.
Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
Interacts with SERPINB1 (By similarity). Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X.
Belongs to the thymosin beta family.
Research Fields
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
References
Application: WB Species: mouse Sample: MSCs and Tβ4-MSCs
Application: WB Species: rat Sample: cortical neurons
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.