Pax-5 Antibody - #AF0238
Product: | Pax-5 Antibody |
Catalog: | AF0238 |
Description: | Rabbit polyclonal antibody to Pax-5 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Horse, Rabbit, Dog |
Mol.Wt.: | 40kDa; 42kD(Calculated). |
Uniprot: | Q02548 |
RRID: | AB_2833413 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0238, RRID:AB_2833413.
Fold/Unfold
B cell lineage specific activator; B cell lineage specific activator protein; B cell specific activator protein; B cell specific transcription factor; B-cell-specific transcription factor; BSAP; EBB-1; KLP; Paired box 5; Paired box gene 5 (B cell lineage specific activator protein); Paired box gene 5 (B cell lineage specific activator); Paired box gene 5; Paired box homeotic gene 5; Paired box protein Pax 5; Paired box protein Pax-5; Paired domain gene 5; PAX 5; PAX5; PAX5_HUMAN; Transcription factor PAX 5;
Immunogens
- Q02548 PAX5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02548 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T9 | Phosphorylation | Uniprot | |
T15 | Phosphorylation | Uniprot | |
Y102 | Phosphorylation | Uniprot | |
S133 | Phosphorylation | Uniprot | |
S168 | Phosphorylation | Uniprot | |
Y179 | Phosphorylation | Uniprot | |
S180 | Phosphorylation | Uniprot | |
S206 | Phosphorylation | Uniprot | |
S298 | Phosphorylation | Uniprot | |
Y299 | Phosphorylation | Uniprot | |
R377 | Methylation | Uniprot |
Research Backgrounds
May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene.
O-glycosylated.
Nucleus.
Interacts with DAXX (By similarity). Binds DNA as a monomer. Binds TLE4. Interacts with ETS1, altering its DNA-binding properties.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.