Osteocalcin Antibody - #DF12303
Product: | Osteocalcin Antibody |
Catalog: | DF12303 |
Description: | Rabbit polyclonal antibody to Osteocalcin |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 11 kDa; 11kD(Calculated). |
Uniprot: | P02818 |
RRID: | AB_2845108 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12303, RRID:AB_2845108.
Fold/Unfold
BGLAP; BGP; Bone gamma carboxyglutamate (gla) protein; Bone gamma carboxyglutamate gla protein osteocalcin; Bone gamma carboxyglutamate protein; Bone Gla protein; Gamma carboxyglutamic acid containing protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; OSTCN_HUMAN; Osteocalcin; OTTHUMP00000016586; PMF1;
Immunogens
- P02818 OSTCN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
Secreted.
Belongs to the osteocalcin/matrix Gla protein family.
References
Application: WB Species: Human Sample: MC3T3-E1 preosteoblasts
Application: IF/ICC Species: rat Sample: calvaria
Application: IHC Species: Rat Sample: bone tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.