MAD2L2 Antibody - #DF12288
![](/images/pubmed.gif)
Product: | MAD2L2 Antibody |
Catalog: | DF12288 |
Description: | Rabbit polyclonal antibody to MAD2L2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 24 kDa; 24kD(Calculated). |
Uniprot: | Q9UI95 |
RRID: | AB_2845093 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12288, RRID:AB_2845093.
Fold/Unfold
Homolog of REV7 S cerevisiae; hREV7; MAD2 (mitotic arrest deficient yeast, homolog) like 2; MAD2 homolog; MAD2 like 2; MAD2 mitotic arrest deficient like 2; MAD2-like protein 2; MAD2B; Mad2l2; MD2L2_HUMAN; Mitotic Arrest Deficient 2 L2; Mitotic arrest deficient 2-like protein 2; Mitotic arrest deficient homolog like 2; Mitotic arrest deficient like 2 (yeast); Mitotic arrest deficient yeast homolog; Mitotic spindle assembly checkpoint protein MAD2B; Polymerase (DNA directed) zeta 2 accessory subunit; POLZ2; REV 7; REV7; REV7 homolog; Weakly similar to Mitotic MAD2 protein (S cerevisiae);
Immunogens
- Q9UI95 MD2L2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UI95 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K44 | Ubiquitination | Uniprot | |
K47 | Ubiquitination | Uniprot | |
K72 | Ubiquitination | Uniprot | |
K90 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
K167 | Ubiquitination | Uniprot | |
K190 | Ubiquitination | Uniprot | |
T191 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end resection. Mediates various NHEJ-dependent processes including immunoglobulin class-switch recombination, and fusion of unprotected telomeres. May also regulate another aspect of cellular response to DNA damage through regulation of the JNK-mediated phosphorylation and activation of the transcriptional activator ELK1. Inhibits the FZR1- and probably CDC20-mediated activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Regulates TCF7L2-mediated gene transcription and may play a role in epithelial-mesenchymal transdifferentiation.
Nucleus. Cytoplasm>Cytoskeleton>Spindle. Cytoplasm. Chromosome.
Note: Recruited to sites of chromosomal double-stranded breaks during G1 and S phase of the cell cycle.
Ubiquitously expressed.
Homooligomer (Probable). Heterodimer with REV3L. This dimer forms the minimal DNA polymerase zeta complex (Pol-zeta2), with REV3L bearing DNA polymerase catalytic activity, although its activity is very low in this context. Component of the tetrameric Pol-zeta complex (Pol-zeta4), which consists of REV3L, MAD2L2, POLD2 and POLD3; Pol-zeta4 is the fully active form of DNA polymerase zeta. Component of the shieldin complex, consisting of SHLD1, SHLD2, SHLD3 and MAD2L2/REV7. Within the complex, SHLD2 forms a scaffold which interacts with a SHLD3-MAD2L2 subcomplex via its N-terminus, and with SHLD1 via its C-terminus. Interacts with REV1. Interacts with ADAM9. Interacts with CHAMP1. Interacts with FZR1 (in complex with the anaphase promoting complex APC). Interacts with CDC20;could not detect the interaction. Interacts with RAN. Interacts with ELK1; the interaction is direct and recruits MAD2L2 to ELK1-specific promoters. May interact with the JNK kinases MAPK8 and/or MAPK9 to stimulate ELK1 phosphorylation and transcriptional activity upon DNA damage. Interacts with TCF7L2; prevents its binding to promoters and negatively modulates its transcriptional activity. Interacts with YY1AP1. Interacts with S.flexneri protein ipaB; prevents the interaction of MAD2L2 with FZR1 and CDC20 resulting in an activation of the anaphase-promoting complex APC and a cell cycle arrest. Interacts with PRCC; the interaction is direct. Interacts with POGZ.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
References
Application: WB Species: Human Sample:
Application: WB Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.