RSAD2 Antibody - #DF12227
| Product: | RSAD2 Antibody |
| Catalog: | DF12227 |
| Description: | Rabbit polyclonal antibody to RSAD2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 43-48 kDa; 42kD(Calculated). |
| Uniprot: | Q8WXG1 |
| RRID: | AB_2845032 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12227, RRID:AB_2845032.
Fold/Unfold
2510004L01Rik; cig 33; CIG 5; cig-33; CIG-5; CIG33; CIG5; Cytomegalovirus induced gene 5 protein; Cytomegalovirus-induced gene 5 protein; endoplasmic reticulum-associated; interferon-inducible; Radical S adenosyl methionine domain containing 2; Radical S-adenosyl methionine domain-containing protein 2; RSAD 2; Rsad2; RSAD2_HUMAN; RSDA-2; VIG 1; vig1; Viperin; Virus inhibitory protein; virus inhibitory protein endoplasmic reticulum associated interferon inducible;
Immunogens
A synthesized peptide derived from human RSAD2, corresponding to a region within the internal amino acids.
- Q8WXG1 RSAD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Interferon-inducible iron-sulfur (4FE-4S) cluster-binding antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Can inhibit a wide range of DNA and RNA viruses, including human cytomegalovirus (HCMV), hepatitis C virus (HCV), west Nile virus (WNV), dengue virus, sindbis virus, influenza A virus, sendai virus, vesicular stomatitis virus (VSV), and human immunodeficiency virus (HIV-1). Displays antiviral activity against influenza A virus by inhibiting the budding of the virus from the plasma membrane by disturbing the lipid rafts. This is accomplished, at least in part, through binding and inhibition of the enzyme farnesyl diphosphate synthase (FPPS), which is essential for the biosynthesis of isoprenoid-derived lipids. Promotes TLR7 and TLR9-dependent production of IFN-beta production in plasmacytoid dendritic cells (pDCs) by facilitating Lys-63'-linked ubiquitination of IRAK1. Plays a role in CD4+ T-cells activation and differentiation. Facilitates T-cell receptor (TCR)-mediated GATA3 activation and optimal T-helper 2 (Th2) cytokine production by modulating NFKB1 and JUNB activities. Can inhibit secretion of soluble proteins.
Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side. Golgi apparatus. Endoplasmic reticulum. Lipid droplet. Mitochondrion. Mitochondrion inner membrane. Mitochondrion outer membrane.
Note: Infection with human cytomegalovirus (HCMV) causes relocation to the Golgi apparatus and to cytoplasmic vacuoles which also contain HCMV proteins glycoprotein B and pp28. Interaction with human cytomegalovirus/HHV-5 protein vMIA/UL37 results in its relocalization from the endoplasmic reticulum to the mitochondria.
The N-terminal region (1-42) is necessary for its localization to the endoplasmic reticulum membrane and lipid droplet.
Belongs to the radical SAM superfamily. RSAD2 family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.