PHGDH Antibody - #DF12220
Product: | PHGDH Antibody |
Catalog: | DF12220 |
Description: | Rabbit polyclonal antibody to PHGDH |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 57 kDa; 57kD(Calculated). |
Uniprot: | O43175 |
RRID: | AB_2845025 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12220, RRID:AB_2845025.
Fold/Unfold
3 PGDH; 3-PGDH; 3-phosphoglycerate dehydrogenase; 3PGDH; D-3-phosphoglycerate dehydrogenase; EC 1.1.1.95; Epididymis secretory protein Li 113; HEL S 113; NLS; NLS1; PDG; PGAD; PGD; PGDH; PGDH3; Phgdh; PHGDHD; Phosphoglycerate dehydrogenase; SERA; SERA_HUMAN;
Immunogens
- O43175 SERA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43175 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R7 | Methylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
S14 | Phosphorylation | Uniprot | |
K21 | Sumoylation | Uniprot | |
K21 | Ubiquitination | Uniprot | |
K33 | Acetylation | Uniprot | |
K33 | Ubiquitination | Uniprot | |
K38 | Ubiquitination | Uniprot | |
S55 | Phosphorylation | Q05513 (PRKCZ) | Uniprot |
T57 | Phosphorylation | Q05513 (PRKCZ) | Uniprot |
K58 | Ubiquitination | Uniprot | |
T60 | Phosphorylation | Uniprot | |
K69 | Ubiquitination | Uniprot | |
R75 | Methylation | Uniprot | |
T78 | Phosphorylation | Q05513 (PRKCZ) | Uniprot |
T89 | Phosphorylation | Uniprot | |
S105 | Phosphorylation | Uniprot | |
T125 | Phosphorylation | Uniprot | |
S127 | Phosphorylation | Uniprot | |
K129 | Ubiquitination | Uniprot | |
K137 | Ubiquitination | Uniprot | |
T141 | Phosphorylation | Uniprot | |
K146 | Ubiquitination | Uniprot | |
T147 | Phosphorylation | Uniprot | |
R236 | Methylation | Uniprot | |
R247 | Methylation | Uniprot | |
C281 | S-Nitrosylation | Uniprot | |
K289 | Acetylation | Uniprot | |
K289 | Ubiquitination | Uniprot | |
K308 | Ubiquitination | Uniprot | |
S326 | Phosphorylation | Uniprot | |
S349 | Phosphorylation | Uniprot | |
K351 | Ubiquitination | Uniprot | |
T353 | Phosphorylation | Uniprot | |
T358 | Phosphorylation | Uniprot | |
S362 | Phosphorylation | Uniprot | |
K364 | Ubiquitination | Uniprot | |
C369 | S-Nitrosylation | Uniprot | |
S371 | Phosphorylation | Uniprot | |
K380 | Ubiquitination | Uniprot | |
K384 | Ubiquitination | Uniprot | |
K394 | Ubiquitination | Uniprot | |
K398 | Ubiquitination | Uniprot | |
S473 | Phosphorylation | Uniprot | |
T480 | Phosphorylation | Uniprot | |
K522 | Ubiquitination | Uniprot |
Research Backgrounds
Catalyzes the reversible oxidation of 3-phospho-D-glycerate to 3-phosphonooxypyruvate, the first step of the phosphorylated L-serine biosynthesis pathway. Also catalyzes the reversible oxidation of 2-hydroxyglutarate to 2-oxoglutarate and the reversible oxidation of (S)-malate to oxaloacetate.
Homotetramer.
Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
Research Fields
· Metabolism > Amino acid metabolism > Glycine, serine and threonine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Carbon metabolism.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.