GSTA4 Antibody - #DF12203
| Product: | GSTA4 Antibody |
| Catalog: | DF12203 |
| Description: | Rabbit polyclonal antibody to GSTA4 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 27 kDa; 26kD(Calculated). |
| Uniprot: | O15217 |
| RRID: | AB_2845008 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12203, RRID:AB_2845008.
Fold/Unfold
DKFZp686D21185; Glutathione S alkyltransferase A4; Glutathione S aralkyltransferase A4; Glutathione S aryltransferase A4; Glutathione S transferase A4 4; Glutathione S transferase A4; Glutathione S transferase alpha 4; Glutathione S-transferase A4; Glutathione S-transferase A4-4; Glutathione transferase A4 4; GST class alpha member 4; GST class-alpha member 4; GSTA4 4; GSTA4; GSTA4_HUMAN; GTA4; OTTHUMP00000016624; OTTHUMP00000016625; S (hydroxyalkyl)glutathione lyase A4;
Immunogens
Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
- O15217 GSTA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O15217 As Substrate
Research Backgrounds
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
Cytoplasm.
Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
Homodimer.
Belongs to the GST superfamily. Alpha family.
Research Fields
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.