TAF12 Antibody - #DF12175
| Product: | TAF12 Antibody |
| Catalog: | DF12175 |
| Description: | Rabbit polyclonal antibody to TAF12 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 21 kDa; 18kD(Calculated). |
| Uniprot: | Q16514 |
| RRID: | AB_2844980 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12175, RRID:AB_2844980.
Fold/Unfold
TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF12_HUMAN; TAF15; TAF2J; TAFII 20/TAFII 15; TAFII-20/TAFII-15; TAFII20; TAFII20/TAFII15; Transcription initiation factor TFIID 20/15 kDa subunits; Transcription initiation factor TFIID subunit 12;
Immunogens
- Q16514 TAF12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16514 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K19 | Sumoylation | Uniprot | |
| T43 | Phosphorylation | Uniprot | |
| S51 | Phosphorylation | Uniprot | |
| T59 | Phosphorylation | Uniprot | |
| K114 | Ubiquitination | Uniprot |
Research Backgrounds
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
Nucleus.
Ubiquitous.
TFIID and PCAF are composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). TBP is not part of TFTC. Interacts directly with TBP; additional interactions between TAFII20 and TAFII28 or TAFII30 were detected. Component of the PCAF complex, at least composed of TADA2L/ADA2, TADA3L/ADA3, TAF5L/PAF65-beta, SUPT3H, TAF6L, TAF9, TAF10, TAF12 and TRRAP. Component of the STAGA transcription coactivator-HAT complex, at least composed of SUPT3H, GCN5L2, TAF5L, TAF6L, STAF65-gamma/KIAA0764, TADA3L, TAD1L, TAF10, TAF12, TRRAP and TAF9. Interacts (isoform TAFII15 and isoform TAFII20) with ATF7 (via the transactivation domain); the interaction is prevented by sumoylation of ATF7 and promotes (isoform TAFII20 only) the transactivation of ATF7.
Belongs to the TAF12 family.
Research Fields
· Genetic Information Processing > Transcription > Basal transcription factors.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.