L2HGDH Antibody - #DF12159
| Product: | L2HGDH Antibody |
| Catalog: | DF12159 |
| Description: | Rabbit polyclonal antibody to L2HGDH |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 46-48 kDa; 50kD(Calculated). |
| Uniprot: | Q9H9P8 |
| RRID: | AB_2844964 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12159, RRID:AB_2844964.
Fold/Unfold
2 hydroxyglutarate dehydrogenase; Alpha hydroxyglutarate oxidoreductase; Alpha ketoglutarate reductase; C14orf160; Duranin; FLJ12618; L alpha hydroxyglutarate dehydrogenase; L-2-hydroxyglutarate dehydrogenase; L-2-hydroxyglutarate dehydrogenase, mitochondrial; L2HDH_HUMAN; l2hgdh; mitochondrial;
Immunogens
Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow.
- Q9H9P8 L2HDH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H9P8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y102 | Phosphorylation | Uniprot | |
| Y103 | Phosphorylation | Uniprot | |
| K104 | Acetylation | Uniprot | |
| K155 | Acetylation | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| R165 | Methylation | Uniprot | |
| K173 | Acetylation | Uniprot | |
| K173 | Ubiquitination | Uniprot | |
| K226 | Ubiquitination | Uniprot | |
| S232 | Phosphorylation | Uniprot | |
| K243 | Ubiquitination | Uniprot | |
| S270 | Phosphorylation | Uniprot | |
| Y285 | Phosphorylation | Uniprot | |
| K297 | Ubiquitination | Uniprot | |
| K334 | Acetylation | Uniprot | |
| S440 | Phosphorylation | Uniprot |
Research Backgrounds
Mitochondrion.
Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow.
Belongs to the L2HGDH family.
Research Fields
· Metabolism > Carbohydrate metabolism > Butanoate metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.