GPX7 Antibody - #DF12156
| Product: | GPX7 Antibody |
| Catalog: | DF12156 |
| Description: | Rabbit polyclonal antibody to GPX7 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | Q96SL4 |
| RRID: | AB_2844961 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12156, RRID:AB_2844961.
Fold/Unfold
CL683; FLJ14777; Glutathione peroxidase 7; GPx-7; GPX6; GPX7; GPX7_HUMAN; GSHPx-7; NPGPx;
Immunogens
Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids.
- Q96SL4 GPX7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96SL4 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y147 | Phosphorylation | Uniprot | |
| T162 | Phosphorylation | Uniprot | |
| S164 | Phosphorylation | Uniprot | |
| T173 | Phosphorylation | Uniprot |
Research Backgrounds
It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.
Secreted.
Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids.
Belongs to the glutathione peroxidase family.
Research Fields
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.