CLTA Antibody - #DF12148
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12148, RRID:AB_2844953.
Fold/Unfold
Clathrin light chain A; Clathrin light chain B; Clathrin light chain LCA; Clathrin light chain LCB; Clathrin light polypeptide A; Clathrin light polypeptide; Clathrin light polypeptide B; Clathrin light polypeptide LCA; Clathrin light polypeptide LCB; Clathrin, light chain (Lcb); Clathrin, light polypeptide (Lca); Clathrin, light polypeptide (Lcb); CLCA_HUMAN; CLTA; CLTB; Lca; LCB;
Immunogens
- P09496 CLCA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09496 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y83 | Phosphorylation | Uniprot | |
| Y84 | Phosphorylation | Uniprot | |
| S87 | Phosphorylation | Uniprot | |
| T91 | Phosphorylation | Uniprot | |
| S93 | Phosphorylation | Uniprot | |
| Y94 | Phosphorylation | Uniprot | |
| S105 | Phosphorylation | Uniprot | |
| S109 | Phosphorylation | Uniprot | |
| S128 | Phosphorylation | Uniprot | |
| K130 | Ubiquitination | Uniprot | |
| K141 | Ubiquitination | Uniprot | |
| Y147 | Phosphorylation | Uniprot | |
| K156 | Ubiquitination | Uniprot | |
| S206 | Phosphorylation | Uniprot | |
| K223 | Methylation | Uniprot | |
| K223 | Ubiquitination | Uniprot | |
| K226 | Methylation | Uniprot | |
| S236 | Phosphorylation | Uniprot | |
| K242 | Acetylation | Uniprot | |
| K242 | Ubiquitination | Uniprot |
Research Backgrounds
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge.
Cytoplasmic vesicle membrane>Peripheral membrane protein>Cytoplasmic side. Membrane>Coated pit>Peripheral membrane protein>Cytoplasmic side. Cytoplasm>Cytoskeleton>Spindle.
Note: Cytoplasmic face of coated pits and vesicles. In complex with TACC3 and CKAP5 (forming the TACC3/ch-TOG/clathrin complex) localized to inter-microtubule bridges in mitotic spindles.
Clathrin coats are formed from molecules containing 3 heavy chains and 3 light chains. Interacts with CALY; the interaction stimulates clathrin self-assembly and clathrin-mediated endocytosis. Interacts with CKAP5 and TACC3 forming the TACC3/ch-TOG/clathrin complex located at spindle inter-microtubules bridges; the complex implicates clathrin triskelions.
Belongs to the clathrin light chain family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.