Estrogen Sulfotransferase Antibody - #DF12137
Product: | Estrogen Sulfotransferase Antibody |
Catalog: | DF12137 |
Description: | Rabbit polyclonal antibody to Estrogen Sulfotransferase |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Rabbit |
Mol.Wt.: | 32-35 kDa; 35kD(Calculated). |
Uniprot: | P49888 |
RRID: | AB_2844942 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12137, RRID:AB_2844942.
Fold/Unfold
EST; EST-1; EST1; Estrogen sulfotransferase; estrogen-preferring; estrone sulfotransferase; ST1E1; ST1E1_HUMAN; STE; Sulfotransferase 1E1; Sulfotransferase; Sulfotransferase estrogen preferring; SULT1E1;
Immunogens
- P49888 ST1E1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49888 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y192 | Phosphorylation | Uniprot | |
K205 | Acetylation | Uniprot |
Research Backgrounds
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. Is a key enzyme in estrogen homeostasis, the sulfation of estrogens leads to their inactivation. Also sulfates dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol and xenobiotic compounds like ethinylestradiol, equalenin, diethyl stilbesterol and 1-naphthol at significantly lower efficiency. Does not sulfonate cortisol, testosterone and dopamine.
Cytoplasm>Cytosol.
Liver, intestine and at lower level in the kidney.
Homodimer.
Belongs to the sulfotransferase 1 family.
Research Fields
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.