NEU4 Antibody - #DF12123
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12123, RRID:AB_2844928.
Fold/Unfold
N acetyl alpha neuraminidase 4; Neuraminidase 4; Sialidase 4;
Immunogens
- Q8WWR8 NEUR4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
PTMs - Q8WWR8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T10 | Phosphorylation | Uniprot | |
| T18 | Phosphorylation | Uniprot | |
| T21 | Phosphorylation | Uniprot | |
| Y22 | Phosphorylation | Uniprot | |
| T193 | Phosphorylation | Uniprot | |
| S194 | Phosphorylation | Uniprot | |
| S197 | Phosphorylation | Uniprot | |
| S202 | Phosphorylation | Uniprot | |
| S335 | Phosphorylation | Uniprot |
Research Backgrounds
May function in lysosomal catabolism of sialylated glycoconjugates. Has sialidase activity towards synthetic substrates, such as 2'-(4-methylumbelliferyl)-alpha-D-N-acetylneuraminic acid (4-MU-NANA or 4MU-NeuAc). Has a broad substrate specificity being active on glycoproteins, oligosaccharides and sialylated glycolipids.
According to phosphorylation of mannose residues may ensure efficient transport of isoform 2 to the lysosomes via the mannose 6-phosphate receptor.
Isoform 2 is glycosylated.
Membrane>Peripheral membrane protein.
Lysosome lumen.
Note: According to PubMed:15213228, isoform 2 is soluble, N-glycosylated and found in the lumen of lysosomes. However, no signal sequence nor N-glycosylation site is predicted from the sequence.
Ubiquitous with higher expression in heart, skeletal muscle, liver and placenta.
Belongs to the glycosyl hydrolase 33 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Other glycan degradation.
· Metabolism > Lipid metabolism > Sphingolipid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.