Spartin, SPG20 Antibody - #DF12086
| Product: | Spartin, SPG20 Antibody |
| Catalog: | DF12086 |
| Description: | Rabbit polyclonal antibody to Spartin, SPG20 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 75 kDa,84 kDa; 73kD(Calculated). |
| Uniprot: | Q8N0X7 |
| RRID: | AB_2844891 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12086, RRID:AB_2844891.
Fold/Unfold
SPARTIN; Spastic paraplegia 20 (Troyer syndrome); TAHCCP1; Trans activated by hepatitis C virus core protein 1;
Immunogens
Ubiquitously expressed, with highest levels of expression detected in adipose tissue.
- Q8N0X7 SPART_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELPEWSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQIVDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8N0X7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| Y45 | Phosphorylation | Uniprot | |
| Y46 | Phosphorylation | Uniprot | |
| K47 | Ubiquitination | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| K97 | Ubiquitination | Uniprot | |
| T101 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| Y114 | Phosphorylation | Uniprot | |
| K287 | Ubiquitination | Uniprot | |
| R334 | Methylation | Uniprot | |
| S357 | Phosphorylation | Uniprot | |
| S358 | Phosphorylation | Uniprot | |
| K362 | Methylation | Uniprot | |
| K362 | Ubiquitination | Uniprot | |
| K370 | Methylation | Uniprot | |
| K370 | Ubiquitination | Uniprot | |
| K377 | Ubiquitination | Uniprot | |
| K382 | Methylation | Uniprot | |
| K390 | Ubiquitination | Uniprot | |
| S393 | Phosphorylation | Uniprot | |
| S400 | Phosphorylation | Uniprot | |
| K412 | Ubiquitination | Uniprot | |
| K414 | Ubiquitination | Uniprot | |
| K422 | Ubiquitination | Uniprot | |
| K440 | Ubiquitination | Uniprot | |
| K447 | Ubiquitination | Uniprot | |
| K451 | Ubiquitination | Uniprot | |
| K455 | Ubiquitination | Uniprot | |
| K465 | Ubiquitination | Uniprot | |
| S470 | Phosphorylation | Uniprot | |
| K475 | Ubiquitination | Uniprot | |
| K481 | Ubiquitination | Uniprot | |
| K489 | Acetylation | Uniprot | |
| K489 | Ubiquitination | Uniprot | |
| C499 | S-Nitrosylation | Uniprot | |
| C504 | S-Nitrosylation | Uniprot | |
| K507 | Ubiquitination | Uniprot | |
| K514 | Ubiquitination | Uniprot | |
| K519 | Ubiquitination | Uniprot | |
| S524 | Phosphorylation | Uniprot | |
| K526 | Ubiquitination | Uniprot | |
| K527 | Ubiquitination | Uniprot | |
| K529 | Ubiquitination | Uniprot | |
| K532 | Ubiquitination | Uniprot | |
| K578 | Sumoylation | Uniprot | |
| K578 | Ubiquitination | Uniprot | |
| K615 | Ubiquitination | Uniprot | |
| Y628 | Phosphorylation | Uniprot | |
| K651 | Ubiquitination | Uniprot |
Research Backgrounds
May be implicated in endosomal trafficking, or microtubule dynamics, or both. Participates in cytokinesis.
Ubiquitinated; ubiquitination does not require ITCH and WWP1.
Cytoplasm. Midbody.
Note: Transiently associated with endosomes (PubMed:19580544). Colocalized with IST1 to the ends of Flemming bodies during cytokinesis (PubMed:20719964).
Ubiquitously expressed, with highest levels of expression detected in adipose tissue.
Interacts with ITCH and WWP1. Interacts (via MIT domain) with IST1; leading to the recruitment of SPART to midbodies.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.