SKAP2 Antibody - #DF12085
| Product: | SKAP2 Antibody |
| Catalog: | DF12085 |
| Description: | Rabbit polyclonal antibody to SKAP2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 55 kDa; 41kD(Calculated). |
| Uniprot: | O75563 |
| RRID: | AB_2844890 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12085, RRID:AB_2844890.
Fold/Unfold
Fyn associated phosphoprotein SKAP55 homologue; MGC10411; MGC33; PRAP; Pyk2/RAFTK associated protein; Pyk2/RAFTK-associated protein; RA70; Retinoic acid-induced protein 70; SAPS; SKAP-55HOM; SKAP-HOM; skap2; SKAP2_HUMAN; SKAP55 homolog; SKAP55R; Src associated adaptor protein; Src family associated phosphoprotein 2; Src family-associated phosphoprotein 2; src kinase associated phosphoprotein of 55 related protein; Src kinase-associated phosphoprotein 2; Src kinase-associated phosphoprotein 55-related protein; Src-associated adapter protein with PH and SH3 domains;
Immunogens
- O75563 SKAP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75563 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S5 | Phosphorylation | Uniprot | |
| S6 | Phosphorylation | Uniprot | |
| T7 | Phosphorylation | Uniprot | |
| S9 | Phosphorylation | Uniprot | |
| Y11 | Phosphorylation | Uniprot | |
| S47 | Phosphorylation | Uniprot | |
| K56 | Ubiquitination | Uniprot | |
| K66 | Ubiquitination | Uniprot | |
| Y75 | Phosphorylation | Uniprot | |
| T85 | Phosphorylation | Uniprot | |
| K119 | Ubiquitination | Uniprot | |
| Y122 | Phosphorylation | Uniprot | |
| K125 | Ubiquitination | Uniprot | |
| T147 | Phosphorylation | Uniprot | |
| Y151 | Phosphorylation | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| S154 | Phosphorylation | Uniprot | |
| K194 | Ubiquitination | Uniprot | |
| Y197 | Phosphorylation | Uniprot | |
| S203 | Phosphorylation | Uniprot | |
| K205 | Ubiquitination | Uniprot | |
| Y237 | Phosphorylation | Uniprot | |
| S253 | Phosphorylation | Uniprot | |
| Y261 | Phosphorylation | Uniprot | |
| K281 | Ubiquitination | Uniprot | |
| S283 | Phosphorylation | Uniprot | |
| S286 | Phosphorylation | Uniprot | |
| T290 | Phosphorylation | Uniprot | |
| Y325 | Phosphorylation | Uniprot | |
| S328 | Phosphorylation | Uniprot | |
| K329 | Ubiquitination | Uniprot | |
| Y331 | Phosphorylation | Uniprot | |
| Y334 | Phosphorylation | Uniprot | |
| K350 | Ubiquitination | Uniprot | |
| Y357 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.
Phosphorylated in resting platelets. Phosphorylated by FYN on Tyr-261 upon T-cell activation (Probable). Dephosphorylated on Tyr-75 by PTPN22.
Cytoplasm.
Ubiquitously expressed. Present in platelets (at protein level).
Homodimer (By similarity). Interacts with PTPNS1. Part of a complex consisting of SKAP2, FYB1 and PTPNS1. Part of a complex consisting of SKAP2, FYB1 and LILRB3. May interact with actin (By similarity). Interacts with FYB1, which is required for SKAP2 protein stability. Interacts with LAT, GRB2, PTK2B and PRAM1. May interact with FYN, HCK and LYN. Interacts with FASLG.
The SH3 domain interacts with FYB1 and PTK2B.
Belongs to the SKAP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.