MAT2B Antibody - #DF12080
Product: | MAT2B Antibody |
Catalog: | DF12080 |
Description: | Rabbit polyclonal antibody to MAT2B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q9NZL9 |
RRID: | AB_2844885 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12080, RRID:AB_2844885.
Fold/Unfold
1110064C04Rik; 2410018D16Rik; AI182287; AU022853; Beta regulatory subunit of methionine adenosyltransferase; dTDP 4 keto 6 deoxy D glucose 4 reductase; DTDP-4-keto-6-deoxy-D-glucose 4-reductase; MAT II; MAT II beta; Mat2b; MAT2B_HUMAN; MATIIbeta; Methionine adenosyltransferase 2 beta subunit; Methionine adenosyltransferase 2 subunit beta; Methionine adenosyltransferase II beta; MGC12237; MSTP045; Nbla02999; OTTMUSP00000005600; Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase; Putative protein product of Nbla02999; RP23-382C18.2; SDR23E1; Short chain dehydrogenase/reductase family 23E member 1; TGR;
Immunogens
A synthesized peptide derived from human MAT2B, corresponding to a region within the internal amino acids.
- Q9NZL9 MAT2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP. Regulates MAT2A catalytic activity by changing its kinetic properties, increasing its affinity for L-methionine. Can bind NADP (in vitro).
Widely expressed.
Belongs to the dTDP-4-dehydrorhamnose reductase family. MAT2B subfamily.
Research Fields
· Metabolism > Amino acid metabolism > Cysteine and methionine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Metabolism > Global and overview maps > Biosynthesis of amino acids.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.