Product: RAB27B Antibody
Catalog: DF12060
Description: Rabbit polyclonal antibody to RAB27B
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 25-30 kDa(Observed); 25kD(Calculated).
Uniprot: O00194
RRID: AB_2844865

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
RAB27B Antibody detects endogenous levels of total RAB27B.
RRID:
AB_2844865
Cite Format: Affinity Biosciences Cat# DF12060, RRID:AB_2844865.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C25KG; Rab27b; RAB27B member RAS oncogene family; RAS associated protein RAB27B; Ras related protein Rab 27b; Ras related protein Rab27b; Ras-related protein Rab-27B; RB27B_HUMAN; Small GTP binding protein rab27b;

Immunogens

Immunogen:

A synthesized peptide derived from human RAB27B, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
O00194 RB27B_HUMAN:

Expressed primarily in testis.

Sequence:
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Rabbit
100
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in NTRK2/TRKB axonal anterograde transport by facilitating the association of NTRK2/TRKB with KLC1. May be involved in targeting uroplakins to urothelial apical membranes (By similarity).

Subcellular Location:

Membrane>Lipid-anchor. Late endosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed primarily in testis.

Family&Domains:

Belongs to the small GTPase superfamily. Rab family.

Research Fields

· Organismal Systems > Digestive system > Pancreatic secretion.

References

1). Immune cell infiltration into brain tumor microenvironment is mediated by Rab27-regulated vascular wall integrity. Science advances, 2025 (PubMed: 40408475) [IF=11.7]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 1. Rab27 controls vascular morphogenesis in the brain. (A) Immunostaining of primary BECs isolated from Rab27-WT mice for CD31 (red), Rab27a (green), and Rab27b (cyan), with 4′,6-diamidino-2-phenylindole (DAPI) (blue) counterstain, imaged at 63× using super-resolution microscopy (SIM). (B) Western blot normalized quantifications to study levels of Rab27a and Rab27b in WT (white), dHET (gray), and dKO (blue) primary BEC isolates. (C to E) Immunostaining of the vasculature using CD31 (red) and DAPI (blue) counterstain on brain tissues derived from Rab27-WT (C), Rab27-dHET (D), and Rab27-dKO (E) mice. (F) Cartoon to show murine neocortex (top) and quantification of total microvascular density in the neocortex (bottom) of WT (white), dHET (gray), and dKO (blue) mice. (G) Layer-related microvascular density counts in the neocortex of WT (white), dHET (gray), and dKO (blue) mice. (H to M) Tube formation assay using primary WT-BECs treated with DMSO (H), 1 μM Nex-20 (I), 2.7 μg of IgG (J), 2.7 μg of anti-Rab27b antibody (K), DMSO + IgG (L), and 1 μM Nex-20 + 2.7 μg of anti-Rab27b antibody (M). (N to Q) Quantifications of the number of nodes (N), junctions (O), meshes (P), and branches (Q), formed by primary WT-BECs after 15 hours in culture. WT, wild type (C57bl/6); dHET, Rab27a/b double heterozygote; dKO, Rab27a/b double knockout; *P < 0.05 and **P < 0.01. Scale bars, 100 µm.

Application: IHC    Species: Mouse    Sample:

Fig. 1. Rab27 controls vascular morphogenesis in the brain. (A) Immunostaining of primary BECs isolated from Rab27-WT mice for CD31 (red), Rab27a (green), and Rab27b (cyan), with 4′,6-diamidino-2-phenylindole (DAPI) (blue) counterstain, imaged at 63× using super-resolution microscopy (SIM). (B) Western blot normalized quantifications to study levels of Rab27a and Rab27b in WT (white), dHET (gray), and dKO (blue) primary BEC isolates. (C to E) Immunostaining of the vasculature using CD31 (red) and DAPI (blue) counterstain on brain tissues derived from Rab27-WT (C), Rab27-dHET (D), and Rab27-dKO (E) mice. (F) Cartoon to show murine neocortex (top) and quantification of total microvascular density in the neocortex (bottom) of WT (white), dHET (gray), and dKO (blue) mice. (G) Layer-related microvascular density counts in the neocortex of WT (white), dHET (gray), and dKO (blue) mice. (H to M) Tube formation assay using primary WT-BECs treated with DMSO (H), 1 μM Nex-20 (I), 2.7 μg of IgG (J), 2.7 μg of anti-Rab27b antibody (K), DMSO + IgG (L), and 1 μM Nex-20 + 2.7 μg of anti-Rab27b antibody (M). (N to Q) Quantifications of the number of nodes (N), junctions (O), meshes (P), and branches (Q), formed by primary WT-BECs after 15 hours in culture. WT, wild type (C57bl/6); dHET, Rab27a/b double heterozygote; dKO, Rab27a/b double knockout; *P < 0.05 and **P < 0.01. Scale bars, 100 µm.

2). Effects of miR‑340 overexpression and knockdown on the proliferation and metastasis of NSCLC cell lines. International Journal of Molecular Medicine, 2019 (PubMed: 31173161) [IF=5.7]

Application: IHC    Species: human    Sample: non‑small cell lung cancer

Figure 2. |Immunohistochemical analysis of RAB family proteins in NSCLC tissues. The expression of the RAB family of proteins, including RAB27A, RAB27B, RAB21, RAB11A and RAB9A in tumor and adjacent tissues of patients with NSCLC was analyzed by immunohistochemistry and observed under an inverted microscope. NSCLC, non‑small cell lung cancer.

Application: WB    Species: human    Sample: non‑small cell lung cancer

Figure 1. |Expression levels of miR‑340 and RAB27B in NSCLC tissues and cell lines. (A) RT‑qPCR analysis of miR‑340 expression levels in 22 paired human NSCLC and adjacent tissues. (B) Quantitative analysis of miR‑340 expression in NSCLC cell lines. (C) RT‑qPCR analysis of RAB27B mRNA expression in 22 paired NSCLC tissues. (D) Quantitative analysis of RAB27B gene expression in NSCLC cell lines. (E) RAB27B protein expression in NSCLC cell lines, as determined by western blotting.

3). Uropathogenic Escherichia coli infection: innate immune disorder, bladder damage, and Tailin Fang II. Frontiers in cellular and infection microbiology, 2024 (PubMed: 38638825) [IF=4.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.