LPCAT1 Antibody - #DF12033

Product: | LPCAT1 Antibody |
Catalog: | DF12033 |
Description: | Rabbit polyclonal antibody to LPCAT1 |
Application: | WB IHC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Zebrafish, Bovine, Horse, Dog, Chicken |
Mol.Wt.: | 59 kDa; 59kD(Calculated). |
Uniprot: | Q8NF37 |
RRID: | AB_2844838 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12033, RRID:AB_2844838.
Fold/Unfold
1 acylglycerophosphocholine O acyltransferase; 1 alkylglycerophosphocholine O acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acetyl CoA:lyso PAF acetyltransferase; Acetyl CoA:lyso platelet activating factor acetyltransferase; Acetyl-CoA:lyso-PAF acetyltransferase; Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; Acyl CoA:lysophosphatidylcholine acyltransferase 1; Acyltransferase like 2; Acyltransferase-like 2; AGPAT10; AGPAT9; AYTL1; AYTL2; FLJ12443; FLJ41609; LPC acyltransferase 1; LPC acyltransferase; lpcat; LPCAT-1; LPCAT1; Lyso PAF acetyltransferase; Lyso-PAF acetyltransferase; LysoPAFAT; LysoPC acyltransferase 1; Lysophosphatidylcholine acyltransferase 1; PCAT1_HUMAN; PFAAP3; Phosphonoformate immuno associated protein 3; Phosphonoformate immuno-associated protein 3;
Immunogens
A synthesized peptide derived from human LPCAT1, corresponding to a region within the internal amino acids.
- Q8NF37 PCAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Possesses both acyltransferase and acetyltransferase activities. Activity is calcium-independent (By similarity). Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively. May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology. Involved in the regulation of lipid droplet number and size.
Endoplasmic reticulum membrane>Single-pass type II membrane protein. Golgi apparatus membrane>Single-pass type II membrane protein. Lipid droplet.
Note: May adopt a monotopic topology when embedded in the lipid monolayer of the lipid droplet, with both termini exposed to the cytoplasm.
The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine.
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.
Research Fields
· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.
· Metabolism > Lipid metabolism > Ether lipid metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
References
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.