Product: Parkin Antibody
Catalog: AF0235
Description: Rabbit polyclonal antibody to Parkin
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 52kDa; 52kD(Calculated).
Uniprot: O60260
RRID: AB_2833410

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Parkin Antibody detects endogenous levels of total Parkin.
RRID:
AB_2833410
Cite Format: Affinity Biosciences Cat# AF0235, RRID:AB_2833410.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AR JP; E3 ubiquitin ligase; E3 ubiquitin protein ligase parkin; E3 ubiquitin-protein ligase parkin; FRA6E; LPRS 2; LPRS2; PARK 2; Park2; Parkin 2; Parkinson disease (autosomal recessive juvenile) 2; Parkinson disease (autosomal recessive, juvenile) 2, parkin; Parkinson disease protein 2; Parkinson juvenile disease protein 2; Parkinson protein 2 E3 ubiquitin protein ligase; Parkinson protein 2, E3 ubiquitin protein ligase (parkin); PDJ; PRKN 2; PRKN; PRKN2; PRKN2_HUMAN; Ubiquitin E3 ligase PRKN;

Immunogens

Immunogen:

A synthesized peptide derived from human Parkin, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
O60260 PRKN_HUMAN:

Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis. Found in serum (at protein level).

Description:
PARK2 Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP, SEPT5 and AIMP2. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2.
Sequence:
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Research Backgrounds

Function:

Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746 and AIMP2. Mediates monoubiquitination as well as 'Lys-6', 'Lys-11', 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context. Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7: 'Lys-63'-linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation. Mediates 'Lys-63'-linked polyubiquitination of a 22 kDa O-linked glycosylated isoform of SNCAIP, possibly playing a role in Lewy-body formation. Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy. Promotes the autophagic degradation of dysfunctional depolarized mitochondria (mitophagy) by promoting the ubiquitination of mitochondrial proteins such as TOMM20, RHOT1/MIRO1 and USP30. Preferentially assembles 'Lys-6'-, 'Lys-11'- and 'Lys-63'-linked polyubiquitin chains following mitochondrial damage, leading to mitophagy. Mediates 'Lys-48'-linked polyubiquitination of ZNF746, followed by degradation of ZNF746 by the proteasome; possibly playing a role in the regulation of neuron death. Limits the production of reactive oxygen species (ROS). Regulates cyclin-E during neuronal apoptosis. In collaboration with CHPF isoform 2, may enhance cell viability and protect cells from oxidative stress. Independently of its ubiquitin ligase activity, protects from apoptosis by the transcriptional repression of p53/TP53. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. May represent a tumor suppressor gene.

PTMs:

Auto-ubiquitinates in an E2-dependent manner leading to its own degradation. Also polyubiquitinated by RNF41 for proteasomal degradation.

S-nitrosylated. The inhibition of PRKN ubiquitin E3 ligase activity by S-nitrosylation could contribute to the degenerative process in PD by impairing the ubiquitination of PRKN substrates.

Phosphorylation at Ser-65 by PINK1 contributes to activate PRKN activity. It is however not sufficient and requires binding to phosphorylated ubiquitin as well.

Subcellular Location:

Cytoplasm>Cytosol. Nucleus. Endoplasmic reticulum. Mitochondrion.
Note: Mainly localizes in the cytosol. Co-localizes with SYT11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. Mitochondrial localization gradually increases with cellular growth. Also relocates to dysfunctional mitochondria that have lost the mitochondrial membrane potential; recruitment to mitochondria is PINK1-dependent.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis. Found in serum (at protein level).

Family&Domains:

The ubiquitin-like domain binds the PSMD4 subunit of 26S proteasomes.

The RING-type 1 zinc finger domain is required to repress p53/TP53 transcription.

Members of the RBR family are atypical E3 ligases. They interact with the E2 conjugating enzyme UBE2L3 and function like HECT-type E3 enzymes: they bind E2s via the first RING domain, but require an obligate trans-thiolation step during the ubiquitin transfer, requiring a conserved cysteine residue in the second RING domain (PubMed:21532592).

Belongs to the RBR family. Parkin subfamily.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum.   (View pathway)

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

References

1). Zinc-mediated metalloimmunotherapy with dual elimination of tumor and intratumoral bacteria in oral squamous cell carcinoma. Biomaterials, 2025 (PubMed: 40450766) [IF=12.0]

2). Sirt3-mediated mitophagy regulates AGEs-induced BMSCs senescence and senile osteoporosis. Redox Biology, 2021 (PubMed: 33662874) [IF=10.7]

Application: WB    Species: mice    Sample: bone marrow mesenchymal stem (BMSCs)

Fig. 2. Effects of different concentrations of AGEs on mitochondrial function and mitophagy of BMSCs. The BMSCs were treated with AGEs (50–200 μg/mL) or BSA for 24–72 h. (A) Representative fluorescence images with DCF (green) staining in BMSCs stimulated with AGEs. Scale bar: 50 μm. (B) Representative fluorescence images with Mito-SOX (red) and Mito-Tracker (green) double-staining in BMSCs stimulated with AGEs. Scale bar: 50 μm. (C) The MMP was detected through JC-1 staining in BMSCs stimulated with AGEs. Scale bar: 50 μm. (D) Representative fluorescence images with Mtphagy Dye (red) and Mito-Tracker (green) double-staining in BMSCs stimulated with AGEs. Scale bar: 50 μm. (E) Representative fluorescence images with LC3B (red) and Mito-Tracker (green) double-staining in BMSCs stimulated with AGEs. Scale bar: 50 μm. (F) Representative Western blotting assay and quantitation of the level of LC3B, P62, Parkin, Sirt3. **p < 0.01 versus BSA. (For interpretation of the references to colour in this figure legend, the reader is referred to the Web version of this article.)

3). Integrating network analysis and experimental validation to reveal the mitophagy-associated mechanism of Yiqi Huoxue (YQHX) prescription in the treatment of myocardial ischemia/reperfusion injury. PHARMACOLOGICAL RESEARCH, 2023 (PubMed: 36736970) [IF=9.1]

4). VEGFR3 mitigates hypertensive nephropathy by enhancing mitophagy via regulating crotonylation of HSPA1L. Cell communication and signaling : CCS, 2025 (PubMed: 39875989) [IF=8.4]

Application: IF/ICC    Species: human    Sample: HK-2 cells

Fig. 4 VEGFR3 improves abnormal mitophagy by enhancing PARKIN mitochondrial translocation. A-C The expression levels of SQSTM1 and LC3 II/LC3 I in mitochondrial lysates were measured after stimulation with 10−6 M Ang II for the indicated time in HK-2 cells. Relative protein levels were calculated as fold changes vs. 0 h group. D, E HK-2 cells overexpressing VEGFR3 were incubated with 10−6 M Ang II for 48 h. Representative immunoblots of SQSTM1 and LC3 II/LC3 I in mitochondria and quantification of blot intensities. F TEM was performed to assess mitochondrial damage in HK-2 cells overexpressing VEGFR3 or Vector, stimulation with or without Ang II. Scale bar, 2 μm. G, H Mitotracker Red labeled mitochondria and Lysotracker Green labeled lysosome. Representative confocal microscopy images of lysosome and mitochondria in HK2 cells and summarized data. Scale bar, 20 μm. I and K Immunoblotting analysis and quantitative results of BNIP3, FUNDC1, PINK1 and PARKIN in mitochondrial lysates of HK-2 cells primed with or without MAZ51, followed by Ang II treatment. J and L TOMM20 (green) labeled mitochondria. The colocalization with PARKIN (red) and mitochondria was monitored by confocal microscopy and summarized data. Scale bar, 20 μm. Data were from three or more independent experiments and were presented as the mean ± SEM. Data in (A) through (L) were analyzed with one-way ANOVA. ns, not significant, *P 

Application: WB    Species: human    Sample: HK-2 cells

Fig. 4 VEGFR3 improves abnormal mitophagy by enhancing PARKIN mitochondrial translocation. A-C The expression levels of SQSTM1 and LC3 II/LC3 I in mitochondrial lysates were measured after stimulation with 10−6 M Ang II for the indicated time in HK-2 cells. Relative protein levels were calculated as fold changes vs. 0 h group. D, E HK-2 cells overexpressing VEGFR3 were incubated with 10−6 M Ang II for 48 h. Representative immunoblots of SQSTM1 and LC3 II/LC3 I in mitochondria and quantification of blot intensities. F TEM was performed to assess mitochondrial damage in HK-2 cells overexpressing VEGFR3 or Vector, stimulation with or without Ang II. Scale bar, 2 μm. G, H Mitotracker Red labeled mitochondria and Lysotracker Green labeled lysosome. Representative confocal microscopy images of lysosome and mitochondria in HK2 cells and summarized data. Scale bar, 20 μm. I and K Immunoblotting analysis and quantitative results of BNIP3, FUNDC1, PINK1 and PARKIN in mitochondrial lysates of HK-2 cells primed with or without MAZ51, followed by Ang II treatment. J and L TOMM20 (green) labeled mitochondria. The colocalization with PARKIN (red) and mitochondria was monitored by confocal microscopy and summarized data. Scale bar, 20 μm. Data were from three or more independent experiments and were presented as the mean ± SEM. Data in (A) through (L) were analyzed with one-way ANOVA. ns, not significant, *P 

5). Betulinic Acid Inhibits ROS-Mediated Pyroptosis in Spinal Cord Injury by Augmenting Autophagy via the AMPK-mTOR-TFEB Signaling Pathway. International Journal of Biological Sciences, 2020 (PubMed: 33867836) [IF=8.2]

Application: WB    Species: Mice    Sample: spinal cords

Figure 6 BA attenuates mitophagy and reduces ROS accumulation after SCI. (A) ELISA of 8-OHdG, AOPP, and MDA in spinal cord lesions from Sham, SCI, BA and BA+3MA groups as indicated. (B) Immunofluorescence staining for Nix and NeuN co-localization in the spinal cords of the Sham, SCI, BA and BA+3MA groups (scale bar = 25 µm). (C) The quantitative mean optical density of the Nix in motor neurons of spinal cord lesion in each group. (D) Western blotting for Bnip3, Nix and Parkin expression levels in the Sham, SCI and BA groups. The gels were run under the same experimental conditions, and the cropped blots are shown here. (E) The optical density values of the Bnip3, Nix and Parkin expression levels were quantified and analyzed in the three groups. (F) Western blotting for Bnip3, Nix and Parkin expression levels in the BA and BA+3MA groups. The gels were run under the same experimental conditions, and the cropped blots are shown here. (G) The optical density values of the Bnip3, Nix and Parkin expression levels were quantified and analyzed in the both groups. The values are expressed as the means ± SEM, n=5 per group. *p< 0.05 and **p< 0.01, vs. Sham group. #p< 0.05 and ##p< 0.01, vs. SCI group. &p< 0.05 and &&p< 0.01, vs. BA group.

Application: WB    Species: Mice    Sample: spinal cords

Figure 6 BA attenuates mitophagy and reduces ROS accumulation after SCI. (A) ELISA of 8-OHdG, AOPP, and MDA in spinal cord lesions from Sham, SCI, BA and BA+3MA groups as indicated. (B) Immunofluorescence staining for Nix and NeuN co-localization in the spinal cords of the Sham, SCI, BA and BA+3MA groups (scale bar = 25 µm). (C) The quantitative mean optical density of the Nix in motor neurons of spinal cord lesion in each group. (D) Western blotting for Bnip3, Nix and Parkin expression levels in the Sham, SCI and BA groups. The gels were run under the same experimental conditions, and the cropped blots are shown here. (E) The optical density values of the Bnip3, Nix and Parkin expression levels were quantified and analyzed in the three groups. (F) Western blotting for Bnip3, Nix and Parkin expression levels in the BA and BA+3MA groups. The gels were run under the same experimental conditions, and the cropped blots are shown here. (G) The optical density values of the Bnip3, Nix and Parkin expression levels were quantified and analyzed in the both groups. The values are expressed as the means ± SEM, n=5 per group. *p< 0.05 and **p< 0.01, vs. Sham group. #p< 0.05 and ##p< 0.01, vs. SCI group. &p< 0.05 and &&p< 0.01, vs. BA group.

6). Downregulation of VEGFA accelerates AGEs-mediated nucleus pulposus degeneration through inhibiting protective mitophagy in high glucose environments. International journal of biological macromolecules, 2024 (PubMed: 38320636) [IF=7.7]

7). SIRT1 activation restores PINK1-dependent mitophagy to reverse airway barrier dysfunction in Acinetobacter baumannii infection. Free radical biology & medicine, 2026 (PubMed: 41895413) [IF=7.1]

8). Zinc ions facilitate metabolic bioenergetic recovery post spinal cord injury by activating microglial mitophagy through the STAT3-FOXO3a-SOD2 pathway. Free radical biology & medicine, 2024 (PubMed: 39613048) [IF=7.1]

9). Nuanxinkang prevents the development of myocardial infarction-induced chronic heart failure by promoting PINK1/Parkin-mediated mitophagy. PHYTOMEDICINE, 2023 (PubMed: 36279758) [IF=6.7]

10). Anemarrhena asphodeloides-derived small extracellular vesicle ameliorate diabetes-induced muscle atrophy via activating Pink1-mediated mitophagy. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 41308393) [IF=6.7]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.