FIS1 Antibody - #DF12005

(8)   (9)  
Product: FIS1 Antibody
Catalog: DF12005
Description: Rabbit polyclonal antibody to FIS1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 17 kDa; 17kD(Calculated).
Uniprot: Q9Y3D6
RRID: AB_2844810

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(92%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
FIS1 Antibody detects endogenous levels of total FIS1.
RRID:
AB_2844810
Cite Format: Affinity Biosciences Cat# DF12005, RRID:AB_2844810.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2010003O14Rik; CGI 135; CGI135; FIS 1; FIS1; Fis1 homolog; FIS1, S. cerevisiae, homolog of; FIS1_HUMAN; Fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae); Fission 1 (mitochondrial outer membrane) homolog (yeast); Fission 1 (mitochondrial outer membrane) homolog; Fission 1 homolog; H NH0132A01.6; hFis 1; hFis1; Mitochondrial fission 1 protein; mitochondrial fission molecule; Tetratricopeptide repeat domain 11; Tetratricopeptide repeat protein 11; TPR repeat protein 11; TTC 11;

Immunogens

Immunogen:
Uniprot:

Q9Y3D6(FIS1_HUMAN) >>Visit HPA database.

Gene(ID):
FIS1(51024)
Sequence:
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Pig
92
Zebrafish
73
Xenopus
58
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9Y3D6 As Substrate

Site PTM Type Enzyme
M1 Acetylation
S10 Phosphorylation
K25 Ubiquitination
S31 Phosphorylation
K46 Ubiquitination
K53 Ubiquitination
K64 Ubiquitination
Y76 Phosphorylation
Y82 Phosphorylation
Y87 Phosphorylation
Y93 Phosphorylation
K108 Ubiquitination
K116 Ubiquitination

Research Backgrounds

Function:

Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.

PTMs:

Ubiquitinated by MARCHF5.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein. Peroxisome membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Interacts with DNM1L/DLP1 through the TPR region. Interacts with MARCHF5. Interacts with MIEF1. Interacts with PEX11A, PEX11B and PEX11G.

Family&Domains:

The C-terminus is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.

Belongs to the FIS1 family.

References

1). Mitochondrial damage are involved in Aflatoxin B1-induced testicular damage and spermatogenesis disorder in mice. Science of The Total Environment, 2020 (PubMed: 31733399) [IF=9.8]

Application: WB    Species: Mice    Sample: testis

Fig. 6 AFB1 inhibited mitochondrial dynamics in mice testis. Male mice were treated with 0, 0.375, 0.75 or 1.5 mg 602 AFB1/kg body weight for 30 d. (A) Representative image of Drp1, Fis1, Mfn1 and Opa1. (B) Relative protein 603 expression levels to GAPDH. (C) Drp1, Fis1, Mfn1 and Opa1 mRNA expressions. CG control group, LG low-dose 604 group, MG mid-dose group, HG high-dose group. The data were expressed as mean ± SD. *P < 0.05 versus CG, 605 **P < 0.01 versus CG.
2). Brain-derived neurotrophic factor mimetic, 7,8-dihydroxyflavone, protects against myocardial ischemia by rebalancing optic atrophy 1 processing. Free Radical Biology and Medicine, 2019 (PubMed: 31574344) [IF=7.4]

Application: WB    Species: mouse    Sample: hearts

Fig. 3.| Effects of 7,8-DHF on histology and ultrastructure of ischemic mouse hearts.(A) Histology of ischemic myocardium after treated with 7,8-DHF for 4 weeks examined by HE staining. Scale bar: 50 μm. (B) Cardiac ultrastructure of ischemic myocardium after treated with 7,8-DHF for 4 weeks examined by electron microscope, magnification 10000× and 30000×. (C) Number of mitochondrial per μm2.(D) Mitochondrial aspect ratio was calculated by the ratio of length/width. (E) Western blot bands of Fis-1 and GAPDH.
3). Ginsenoside CK improves skeletal muscle insulin resistance by activating DRP1/PINK1-mediated mitophagy. Food & Function, 2023 (PubMed: 36562271) [IF=6.1]
4). Valproic acid regulates MIEF1 through MST2-HIPPO to suppress breast cancer growth. Life sciences, 2022 (PubMed: 36126724) [IF=6.1]
5). Silibinin Induces G2/M Cell Cycle Arrest by Activating Drp1-Dependent Mitochondrial Fission in Cervical Cancer. Frontiers in Pharmacology, 2020 (PubMed: 32226384) [IF=5.6]

Application: WB    Species: human    Sample: cervical cancer cells

FIGURE 6 | SB impaired mitochondrial fission in cervical cancer cells. (B) The mitochondrial fission related protein expression extracted from cervical cancer cells. Drp1 expression was increased in both two cervical cancer cells. The mitochondrial fission related protein and gene expression level in cervical cancer cells were detected by western blotting and qPCR, respectively. Values (mean ± SDs) were obtained from at least three independent experiments.*P < 0.05, **P < 0.01, and ***P < 0.001 by one-way ANOVA with Tukey’s test.
6). Paeoniflorin Ameliorates Skeletal Muscle Atrophy in Chronic Kidney Disease via AMPK/SIRT1/PGC-1α-Mediated Oxidative Stress and Mitochondrial Dysfunction. Frontiers in Pharmacology, 2022 (PubMed: 35370668) [IF=5.6]

Application: WB    Species: rat    Sample: C2C12 cells

FIGURE 8 | PGC-1α might be important in mediating the effects of PF on TNF-α-treated C2C12 cells.(I) Representative western blots using antibodies against p-DRP1 (Ser616), DRP1, FIS1, MFF, MTFP1 and GAPDH.
7). GSDMD induces hepatocyte pyroptosis to trigger alcoholic hepatitis through modulating mitochondrial dysfunction. Cell division, 2024 (PubMed: 38532477) [IF=2.3]
8). Small-molecule 7,8-dihydroxyflavone counteracts compensated and decompensated cardiac hypertrophy via AMPK activation. Journal of Geriatric Cardiology : JGC, 2022 (PubMed: 36561053)

Application: WB    Species: Mouse    Sample:

Figure 4 Protein expression of mitochondria-related factors in the ventricles of 7,8-DHF-treated hypertrophic mice. (A–F): Representative Western blots (left) and quantification (right) of mitochondria-related factors, including Mfn2, OPA1, Drp1, Fis-1, COX-IV, and PGC-1α in left ventricles from the sham, TAC for 4 weeks, and 7,8-DHF-treated groups. Data are expressed as mean ± SE. N = 4 the in sham group; n = 6 in the TAC, and +7,8-DHF groups for Mfn2, OPA1, and Drp1; and n = 4 in each group for Fis-1. Data are expressed as mean ± SE. **P < 0.01 vs. sham, #P < 0.05 vs. TAC. 7,8-DHF: 7,8-dihydroxyflavone; TAC: transverse aortic constriction.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.