PAR4 Antibody - #AF4785
Product: | PAR4 Antibody |
Catalog: | AF4785 |
Description: | Rabbit polyclonal antibody to PAR4 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 43kDa; 37kD(Calculated). |
Uniprot: | Q96IZ0 |
RRID: | AB_2844776 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4785, RRID:AB_2844776.
Fold/Unfold
2310001G03Rik; PAR 4; PAR-4; Pawr; PAWR_HUMAN; PRKC Apoptosis WT1 Regulator; PRKC apoptosis WT1 regulator protein; Prostate apoptosis response 4 protein; Prostate apoptosis response protein 4; prostate apoptosis response protein PAR-4; Transcriptional repressor Par-4-like protein PAWR; Transcriptional repressor PAR4; WT1 Interacting Protein;
Immunogens
Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
- Q96IZ0 PAWR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96IZ0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T8 | Phosphorylation | Uniprot | |
S15 | Phosphorylation | Uniprot | |
S95 | Phosphorylation | Uniprot | |
T99 | Phosphorylation | Uniprot | |
S108 | Phosphorylation | Uniprot | |
K146 | Methylation | Uniprot | |
S162 | Phosphorylation | Uniprot | |
T163 | Phosphorylation | Uniprot | |
C173 | S-Nitrosylation | Uniprot | |
Y177 | Phosphorylation | Uniprot | |
S223 | Phosphorylation | Uniprot | |
Y226 | Phosphorylation | Uniprot | |
K227 | Methylation | Uniprot | |
K227 | Ubiquitination | Uniprot | |
S228 | Phosphorylation | Uniprot | |
T229 | Phosphorylation | Uniprot | |
T230 | Phosphorylation | Uniprot | |
S231 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S233 | Phosphorylation | Uniprot | |
Y241 | Phosphorylation | Uniprot | |
S242 | Phosphorylation | Uniprot | |
S259 | Phosphorylation | Uniprot | |
T261 | Phosphorylation | Uniprot | |
T267 | Phosphorylation | Uniprot | |
K277 | Ubiquitination | Uniprot | |
K296 | Acetylation | Uniprot | |
K296 | Ubiquitination | Uniprot | |
K302 | Acetylation | Uniprot | |
K304 | Ubiquitination | Uniprot | |
K329 | Ubiquitination | Uniprot | |
K333 | Ubiquitination | Uniprot |
Research Backgrounds
Pro-apoptotic protein capable of selectively inducing apoptosis in cancer cells, sensitizing the cells to diverse apoptotic stimuli and causing regression of tumors in animal models. Induces apoptosis in certain cancer cells by activation of the Fas prodeath pathway and coparallel inhibition of NF-kappa-B transcriptional activity. Inhibits the transcriptional activation and augments the transcriptional repression mediated by WT1. Down-regulates the anti-apoptotic protein BCL2 via its interaction with WT1. Seems also to be a transcriptional repressor by itself. May be directly involved in regulating the amyloid precursor protein (APP) cleavage activity of BACE1.
Preferentially phosphorylated at the Thr-163 by PKC in cancer cells.
Cytoplasm. Nucleus.
Note: Mainly cytoplasmic in absence of apoptosis signal and in normal cells. Nuclear in most cancer cell lines. Nuclear entry seems to be essential but not sufficient for apoptosis (By similarity). Nuclear localization includes nucleoplasm and PML nuclear bodies.
Widely expressed. Expression is elevated in various neurodegenerative diseases such as amyotrophic lateral sclerosis, Alzheimer, Parkinson and Huntington diseases and stroke. Down-regulated in several cancers.
Homooligomer. Interacts (via the C-terminal region) with WT1. Interacts with THAP1. Interacts with AATF. Interacts with BACE1. Interacts with SPSB1 (via B30.2/SPRY domain); this interaction is direct and occurs in association with the Elongin BC complex. Interacts with SPSB2 (via B30.2/SPRY domain); this interaction occurs in association with the Elongin BC complex. Interacts with SPSB4 (via B30.2/SPRY domain); this interaction occurs in association with the Elongin BC complex. Component of a ternary complex composed of SQSTM1 and PRKCZ. Interacts with actin (By similarity).
The leucine-zipper domain is not essential for apoptosis, but is required for sensitization of cells to exogenous apoptotic insults and for interaction with its partners.
The SAC domain is a death-inducing domain selective for apoptosis induction in cancer cells. This domain is essential for nuclear entry, Fas activation, inhibition of NF-kappa-B activity and induction of apoptosis in cancer cells (By similarity).
The B30.2/SPRY domain-binding motif mediates recognition by proteins containing a B30.2/SPRY domain.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.