Product: CDC20 Antibody
Catalog: AF4759
Description: Rabbit polyclonal antibody to CDC20
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 50kDa; 55kD(Calculated).
Uniprot: Q12834
RRID: AB_2844753

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
CDC20 Antibody detects endogenous levels of total CDC20.
RRID:
AB_2844753
Cite Format: Affinity Biosciences Cat# AF4759, RRID:AB_2844753.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

bA276H19.3; Cdc 20; CDC20; CDC20 cell division cycle 20 homolog; CDC20_HUMAN; CDC20A; Cell division cycle 20; Cell division cycle 20 homolog (S. cerevisiae); Cell division cycle 20 homolog; Cell division cycle protein 20 homolog; fizzy; MGC102824; p55CDC;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Xenopus
64
Chicken
64
Zebrafish
55
Sheep
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q12834 As Substrate

Site PTM Type Enzyme
Ubiquitination
K33 Methylation
S41 Phosphorylation PR:O43683 (hBUB1) , O43683 (BUB1)
S49 Phosphorylation
S51 Phosphorylation
T55 Phosphorylation
T59 Phosphorylation
K62 Ubiquitination
S63 Phosphorylation
S64 Phosphorylation
K66 Acetylation
K66 Ubiquitination
T69 Phosphorylation
T70 Phosphorylation
S72 Phosphorylation PR:O43683 (hBUB1) , O43683 (BUB1)
K73 Ubiquitination
Y79 Phosphorylation
S84 Phosphorylation
S92 Phosphorylation O43683 (BUB1) , PR:O43683 (hBUB1)
S96 Phosphorylation
K97 Ubiquitination
T106 Phosphorylation
K109 Sumoylation
K109 Ubiquitination
K114 Ubiquitination
K129 Ubiquitination
S134 Phosphorylation
K136 Ubiquitination
K149 Ubiquitination
Y152 Phosphorylation
S153 Phosphorylation O43683 (BUB1) , PR:O43683 (hBUB1)
K155 Ubiquitination
T157 Phosphorylation O43683 (BUB1) , PR:O43683 (hBUB1)
S160 Phosphorylation
S161 Phosphorylation PR:O43683 (hBUB1) , O43683 (BUB1)
T164 Phosphorylation
S170 Phosphorylation P53350 (PLK1)
R174 Methylation
K259 Ubiquitination
S285 Phosphorylation
K435 Ubiquitination
K440 Ubiquitination
S448 Phosphorylation
T457 Phosphorylation
T466 Phosphorylation
K485 Ubiquitination
S487 Phosphorylation
K490 Sumoylation
K490 Ubiquitination
S492 Phosphorylation

Research Backgrounds

Function:

Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.

PTMs:

Acetylated. Deacetylated at Lys-66 by SIRT2; deacetylation enhances the interaction of CDC20 with CDC27, leading to activation of anaphase promoting complex/cyclosome (APC/C).

Phosphorylated during mitosis, probably by maturation promoting factor (MPF). Phosphorylated by BUB1 at Ser-41; Ser-72; Ser-92; Ser-153; Thr-157 and Ser-161. Phosphorylated by NEK2.

Dephosphorylated by CTDP1.

Ubiquitinated and degraded by the proteasome during spindle assembly checkpoint. Deubiquitinated by USP44, leading to stabilize the MAD2L1-CDC20-APC/C ternary complex, thereby preventing premature activation of the APC/C. Ubiquitinated at Lys-490 during prometaphase. Ubiquitination at Lys-485 and Lys-490 has no effect on its ability to bind the APC/C complex.

Subcellular Location:

Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle pole.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Found in a complex with CDC20, CDC27, SPATC1 and TUBG1. Interacts with NEUROD2 and SPATC1 (By similarity). Interacts with MAD2L1 and BUB1B. The phosphorylated form interacts with APC/C. Interacts with NINL. May interact with MAD2L2. Interacts with CDK5RAP2 and SIRT2. Interacts with isoform 1 of NEK2. Interacts with HSF1 (via phosphorylated form); this interaction occurs in mitosis in a MAD2L1-dependent manner and prevents PLK1-stimulated degradation of HSF1 by blocking the recruitment of the SCF(BTRC) ubiquitin ligase complex. Interacts (via the N-terminal substrate-binding domain) with FBXO5 (By similarity).

Family&Domains:

Belongs to the WD repeat CDC20/Fizzy family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

References

1). CDC20 is a novel biomarker for improved clinical predictions in epithelial ovarian cancer. American Journal of Cancer Research, 2022 (PubMed: 35968331) [IF=3.6]

Application: WB    Species: Human    Sample: ovarian cancer cell

Figure 4 A. qRT-PCR detection of CDC20 and SOX2 expression in ovarian cancer cell lines. B. Western blot detection of CDC20 and SOX2 expression in ovarian cancer cell lines. C. Proliferation ability of ovarian cancer cells after silencing CDC20. D. Quadrant of apoptosis in flow cytometry. E. Transwell assays to investigate migratory ablilities of ovarian cancer cell lines transfected with shRNA-NC or shRNA01, 02, 03. Sample size =4. F. qRT-PCR detection of E-cadherin, BAX, BCL-2, Cyclin D1 and Cyclin D2 expression in ovarian cancer cell lines. ****P<0.0001, ***P<0.001, *P<0.05, compared with shRNA-NC.

2). Kinesin family member 2C aggravates the progression of hepatocellular carcinoma and interacts with competing endogenous RNA. Journal of Cellular Biochemistry, 2020 (PubMed: 32056305) [IF=3.0]

Application: WB    Species: human    Sample: HCCcell

FIGURE 4 |The regulation of KIF2C‐mediated mechanism in HCC progression. A, The genes co‐expressed with KIF2C in HCC specimens. B, The KIF2C associated signaling pathway performed by KEGG enrichment analysis. C, The protein interaction with KIF2C predicted by STRING web tool. D, The expression of PCNA and CDC20 after KIF2C overexpression detected by western blot assay.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.