PP2A-alpha Antibody - #AF4753
Product: | PP2A-alpha Antibody |
Catalog: | AF4753 |
Description: | Rabbit polyclonal antibody to PP2A-alpha |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 35kDa; 36kD(Calculated). |
Uniprot: | P67775 |
RRID: | AB_2844748 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4753, RRID:AB_2844748.
Fold/Unfold
PP2A alpha; PP2A-alpha; PP2AA_HUMAN; PP2Aalpha; PP2Ac; PP2CA; PP2Calpha; PPP2CA; Protein phosphatase 2 (formerly 2A) catalytic subunit alpha isoform; Protein phosphatase 2 catalytic subunit alpha isoform; Protein phosphatase 2, catalytic subunit, alpha isozyme; Protein phosphatase 2A catalytic subunit, alpha isoform; Replication protein C; RP C; RP-C; RPC; Serine/threonine protein phosphatase 2A catalytic subunit alpha isoform; Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform;
Immunogens
- P67775 PP2AA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P67775 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K4 | Acetylation | Uniprot | |
K4 | Sumoylation | Uniprot | |
K4 | Ubiquitination | Uniprot | |
K8 | Sumoylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
K21 | Ubiquitination | Uniprot | |
S26 | Phosphorylation | Uniprot | |
K29 | Acetylation | Uniprot | |
K29 | Ubiquitination | Uniprot | |
K34 | Ubiquitination | Uniprot | |
K36 | Ubiquitination | Uniprot | |
K41 | Acetylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
K74 | Ubiquitination | Uniprot | |
S75 | Phosphorylation | Uniprot | |
T78 | Phosphorylation | Uniprot | |
Y86 | Phosphorylation | Uniprot | |
K136 | Ubiquitination | Uniprot | |
S212 | Phosphorylation | Uniprot | |
Y248 | Phosphorylation | Uniprot | |
Y265 | Phosphorylation | Uniprot | |
C266 | S-Nitrosylation | Uniprot | |
K283 | Ubiquitination | Uniprot | |
Y284 | Phosphorylation | Uniprot | |
R295 | Methylation | Uniprot | |
T304 | Phosphorylation | Uniprot | |
Y307 | Phosphorylation | P06213 (INSR) , P00533 (EGFR) , P06239 (LCK) , P12931 (SRC) | Uniprot |
L309 | Methylation | Uniprot |
Research Backgrounds
PP2A is the major phosphatase for microtubule-associated proteins (MAPs). PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Cooperates with SGO2 to protect centromeric cohesin from separase-mediated cleavage in oocytes specifically during meiosis I (By similarity). Can dephosphorylate SV40 large T antigen and p53/TP53. Activates RAF1 by dephosphorylating it at 'Ser-259'.
Reversibly methyl esterified on Leu-309 by leucine carboxyl methyltransferase 1 (LCMT1) and protein phosphatase methylesterase 1 (PPME1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization.
Phosphorylation of either threonine (by autophosphorylation-activated protein kinase) or tyrosine results in inactivation of the phosphatase. Auto-dephosphorylation has been suggested as a mechanism for reactivation.
Polyubiquitinated, leading to its degradation by the proteasome.
Cytoplasm. Nucleus. Chromosome>Centromere. Cytoplasm>Cytoskeleton>Spindle pole.
Note: In prometaphase cells, but not in anaphase cells, localizes at centromeres. During mitosis, also found at spindle poles. Centromeric localization requires the presence of SGO2 (By similarity).
PP2A consists of a common heterodimeric core enzyme, composed of PPP2CA a 36 kDa catalytic subunit (subunit C) and PPP2R1A a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with NXN; the interaction is direct (By similarity). Interacts with KCTD20 (By similarity). Interacts with BTBD10 (By similarity). Interacts with SGO1 and SGO2. Interacts with TP53. Interacts with AXIN1; the interaction dephosphorylates AXIN1. Interacts with PIM3; this interaction promotes dephosphorylation, ubiquitination and proteasomal degradation of PIM3. Interacts with RAF1. Interaction with IGBP1 protects unassembled PPP2CA from degradative ubiquitination. Interacts with GSK3B (via C2 domain). Interacts with MFHAS1; retains PPP2CA into the cytoplasm and excludes it from the nucleus. Interacts with FAM122A. Interacts with ADCY8; interaction is phosphatase activity-dependent; antagonizes interaction between ADCY8 and calmodulin. Interacts with CRTC3 (when phosphorylated at 'Ser-391').
Belongs to the PPP phosphatase family. PP-1 subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - other. (View pathway)
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signal transduction > Sphingolipid signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > AMPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Genetic Information Processing > Translation > mRNA surveillance pathway.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Nervous system > Dopaminergic synapse.
· Organismal Systems > Nervous system > Long-term depression.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.