HCLS1 Antibody - #AF4707
Product: | HCLS1 Antibody |
Catalog: | AF4707 |
Description: | Rabbit polyclonal antibody to HCLS1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Horse, Rabbit, Chicken |
Mol.Wt.: | 78kDa; 54kD(Calculated). |
Uniprot: | P14317 |
RRID: | AB_2844712 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4707, RRID:AB_2844712.
Fold/Unfold
Cortactin like; CTTNL; HCLS 1; Hcls1; HCLS1_HUMAN; Hematopoietic cell specific Lyn substrate 1; Hematopoietic cell-specific LYN substrate 1; Hematopoietic lineage cell-specific protein; HS 1; HS1; LckBP1; OTTHUMP00000215180; OTTHUMP00000215182; p75;
Immunogens
- P14317 HCLS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14317 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S13 | Phosphorylation | Uniprot | |
T16 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
T23 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S32 | Phosphorylation | Uniprot | |
K34 | Ubiquitination | Uniprot | |
K41 | Acetylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
T42 | Phosphorylation | Uniprot | |
K60 | Ubiquitination | Uniprot | |
S62 | Phosphorylation | Uniprot | |
Y83 | Phosphorylation | Uniprot | |
S97 | Phosphorylation | Uniprot | |
Y103 | Phosphorylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
K123 | Acetylation | Uniprot | |
K123 | Ubiquitination | Uniprot | |
Y124 | Phosphorylation | Uniprot | |
S134 | Phosphorylation | Uniprot | |
Y140 | Phosphorylation | Uniprot | |
K141 | Acetylation | Uniprot | |
Y153 | Phosphorylation | Uniprot | |
S154 | Phosphorylation | Uniprot | |
R155 | Methylation | Uniprot | |
Y161 | Phosphorylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
Y175 | Phosphorylation | Uniprot | |
Y177 | Phosphorylation | Uniprot | |
T181 | Phosphorylation | Uniprot | |
S186 | Phosphorylation | Uniprot | |
Y190 | Phosphorylation | Uniprot | |
K192 | Acetylation | Uniprot | |
K192 | Ubiquitination | Uniprot | |
Y198 | Phosphorylation | Uniprot | |
S208 | Phosphorylation | Uniprot | |
T219 | Phosphorylation | Uniprot | |
T220 | Phosphorylation | Uniprot | |
Y222 | Phosphorylation | P07948 (LYN) , P09769 (FGR) | Uniprot |
K223 | Acetylation | Uniprot | |
K224 | Acetylation | Uniprot | |
S232 | Phosphorylation | Uniprot | |
K239 | Ubiquitination | Uniprot | |
K241 | Acetylation | Uniprot | |
T272 | Phosphorylation | Uniprot | |
S275 | Phosphorylation | Uniprot | |
T308 | Phosphorylation | Uniprot | |
T333 | Phosphorylation | Uniprot | |
Y360 | Phosphorylation | Uniprot | |
Y378 | Phosphorylation | P07948 (LYN) , P43405 (SYK) | Uniprot |
Y397 | Phosphorylation | P09769 (FGR) , P07948 (LYN) , P43405 (SYK) | Uniprot |
Y481 | Phosphorylation | Uniprot |
Research Backgrounds
Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.
Phosphorylated by FES (By similarity). Phosphorylated by LYN, FYN and FGR after cross-linking of surface IgM on B-cells. Phosphorylation by LYN, FYN and FGR requires prior phosphorylation by SYK or FES.
Membrane>Peripheral membrane protein. Cytoplasm. Mitochondrion.
Expressed only in tissues and cells of hematopoietic origin.
Associates with the SH2 and SH3 domains of LCK. Binding to he LCK SH3 domain occurs constitutively, while binding to the LCK SH2 domain occurs only upon TCR stimulation. A similar binding pattern was observed with LYN, but not with FYN in which the FYN SH2 region associates upon TCR stimulation but the FYN SH3 region does not associate regardless of TCR stimulation. Directly associates with HAX1, through binding to its C-terminal region. Interacts with HS1BP3. Interacts with FES/FPS (By similarity). Interacts (via SH2 domain) with FGR. Forms a multiprotein complex with LYN and ANKRD54 (By similarity).
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.