CD79B Antibody - #AF4649
Product: | CD79B Antibody |
Catalog: | AF4649 |
Description: | Rabbit polyclonal antibody to CD79B |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 14kDa, 30-50kDa; 26kD(Calculated). |
Uniprot: | P40259 |
RRID: | AB_2844591 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4649, RRID:AB_2844591.
Fold/Unfold
AGM6; B cell antigen receptor complex associated protein beta chain; B cell specific glycoprotein B29; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; B29; B29/Ig-beta/CD79b; CD 79b; CD79b; CD79b antigen (immunoglobulin associated beta); CD79b antigen; CD79b molecule; CD79b molecule immunoglobulin associated beta; CD79b protein; CD79B_HUMAN; Ig beta; Ig-beta; IGB; Igbeta; Immunoglobulin associated B29; Immunoglobulin associated B29 protein; Immunoglobulin associated beta; Immunoglobulin associated protein; Immunoglobulin-associated B29 protein; MGC108607;
Immunogens
- P40259 CD79B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P40259 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S99 | Phosphorylation | Uniprot | |
S146 | Phosphorylation | Uniprot | |
K152 | Ubiquitination | Uniprot | |
T195 | Phosphorylation | Uniprot | |
Y196 | Phosphorylation | P06241 (FYN) , P51451 (BLK) , P07948 (LYN) | Uniprot |
Y207 | Phosphorylation | P51451 (BLK) , P07948 (LYN) , P06241 (FYN) | Uniprot |
K219 | Ubiquitination | Uniprot | |
S221 | Phosphorylation | Uniprot |
Research Backgrounds
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Phosphorylated on tyrosine upon B-cell activation by SRC-type Tyr-kinases such as BLK, LYN and SYK.
Cell membrane>Single-pass type I membrane protein.
Note: Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur outside lipid rafts.
B-cells.
Heterodimer of alpha and beta chains; disulfide-linked. Part of the B-cell antigen receptor complex where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin of two heavy chains and two light chains. Interacts with LYN (By similarity).
Research Fields
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.