DKK1 Antibody - #AF4600
| Product: | DKK1 Antibody |
| Catalog: | AF4600 |
| Description: | Rabbit polyclonal antibody to DKK1 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Xenopus |
| Mol.Wt.: | 28-40kDa; 29kD(Calculated). |
| Uniprot: | O94907 |
| RRID: | AB_2844558 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4600, RRID:AB_2844558.
Fold/Unfold
Dickkopf 1; Dickkopf 1 homolog; Dickkopf 1 like; Dickkopf homolog 1; Dickkopf like protein 1; Dickkopf related protein 1; Dickkopf WNT signaling pathway inhibitor 1; Dickkopf-1; Dickkopf-related protein 1; DKK 1; Dkk-1; Dkk1; DKK1_HUMAN; hDkk 1; hDkk-1; SK;
Immunogens
A synthesized peptide derived from human DKK1, corresponding to a region within the internal amino acids.
- O94907 DKK1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity (By similarity).
Secreted.
Placenta.
The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
Belongs to the dickkopf family.
Research Fields
· Environmental Information Processing > Signal transduction > Wnt signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample: SMSCs
Application: IF/ICC Species: Mouse Sample: SMSCs
Application: IF/ICC Species: Mouse Sample:
Application: WB Species: Human Sample: lung tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.