Phospho-TOB1 (Ser164) Antibody - #AF4439
| Product: | Phospho-TOB1 (Ser164) Antibody |
| Catalog: | AF4439 |
| Description: | Rabbit polyclonal antibody to Phospho-TOB1 (Ser164) |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Xenopus |
| Mol.Wt.: | 38kDa; 38kD(Calculated). |
| Uniprot: | P50616 |
| RRID: | AB_2844503 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4439, RRID:AB_2844503.
Fold/Unfold
APRO 6; APRO6; MGC104792; MGC34446; PIG 49; PIG49; Proliferation inducing gene 49; Protein Tob1; RP23 244C22.1; TOB 1; Tob 1 protein; TOB; TOB1; Tob1 protein; Transducer of ERBB 2 1; Transducer of erbB 2; Transducer of ERBB2 1; Transducer of erbB2; Trob; TROB 1; TROB1;
Immunogens
- P50616 TOB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P50616 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y40 | Phosphorylation | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K110 | Ubiquitination | Uniprot | |
| K126 | Ubiquitination | Uniprot | |
| S152 | Phosphorylation | P45984 (MAPK9) , P28482 (MAPK1) , P27361 (MAPK3) | Uniprot |
| S154 | Phosphorylation | P28482 (MAPK1) , P27361 (MAPK3) , P45984 (MAPK9) | Uniprot |
| S164 | Phosphorylation | P45984 (MAPK9) , P28482 (MAPK1) , P27361 (MAPK3) | Uniprot |
| T204 | Phosphorylation | Uniprot | |
| S205 | Phosphorylation | Uniprot | |
| S268 | Phosphorylation | Uniprot |
Research Backgrounds
Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Mediates CPEB3-accelerated mRNA deadenylation by binding to CPEB3 and recruiting CNOT7 which leads to target mRNA deadenylation and decay.
Phosphorylated on Ser and Thr residues.
Cytoplasm. Nucleus.
Note: Only a small fraction localizes to the cytoplasm except in late S-phase where more than half of proteins become cytoplasmic.
Ubiquitous.
Interacts with ERBB2. Interacts with CNOT7. Interacts with CPEB3 (via C-terminal RNA-binding region); recruits CNOT7 to CPEB3 to form a ternary complex required for mRNA deadenylation and decay. Interacts with CNOT8. Interacts with CPEB4.
Belongs to the BTG family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.