Phospho-GRAP2 (Thr262) Antibody - #AF4322
Product: | Phospho-GRAP2 (Thr262) Antibody |
Catalog: | AF4322 |
Description: | Rabbit polyclonal antibody to Phospho-GRAP2 (Thr262) |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 25,38 kDa; 38kD(Calculated). |
Uniprot: | O75791 |
RRID: | AB_2844401 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4322, RRID:AB_2844401.
Fold/Unfold
Adapter protein GRID; GADS; GADS protein; GRAP-2; Grap2; GRAP2_HUMAN; GRB-2-like protein; GRB2-related adapter protein 2; GRB2-related adaptor protein 2; GRB2-related protein with insert domain; GRB2L; GRBLG; GRBX; Grf-40; Grf40 adapter protein; Grf40; GRID; Growth factor receptor-binding protein; Growth factor receptor-bound protein 2-related adaptor protein 2; GRPL; Hema; Hematopoietic cell-associated adapter protein GrpL; Hematopoietic cell-associated adaptor protein GRPL; Mona; p38; Protein GADS; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule;
Immunogens
- O75791 GRAP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75791 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K36 | Ubiquitination | Uniprot | |
S41 | Phosphorylation | Uniprot | |
Y45 | Phosphorylation | Uniprot | |
K48 | Ubiquitination | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K106 | Acetylation | Uniprot | |
K112 | Ubiquitination | Uniprot | |
K121 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
Y131 | Phosphorylation | Uniprot | |
K141 | Ubiquitination | Uniprot | |
S159 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
S181 | Phosphorylation | Uniprot | |
S187 | Phosphorylation | Uniprot | |
T192 | Phosphorylation | Uniprot | |
Y207 | Phosphorylation | Uniprot | |
Y222 | Phosphorylation | Uniprot | |
R233 | Methylation | Uniprot | |
S236 | Phosphorylation | Uniprot | |
T246 | Phosphorylation | Uniprot | |
S250 | Phosphorylation | Uniprot | |
T262 | Phosphorylation | Uniprot | |
Y324 | Phosphorylation | Uniprot |
Research Backgrounds
Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.
Nucleus. Cytoplasm. Endosome.
Interacts with phosphorylated LIME1 upon TCR activation (By similarity). Interacts with phosphorylated LAT and LAX1 upon TCR activation. Interacts with SHB. Interacts with PTPN23.
Belongs to the GRB2/sem-5/DRK family.
Research Fields
· Organismal Systems > Immune system > T cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.