PDE6G Antibody - #DF10358
Product: | PDE6G Antibody |
Catalog: | DF10358 |
Description: | Rabbit polyclonal antibody to PDE6G |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
Mol.Wt.: | 9KD; 10kD(Calculated). |
Uniprot: | P18545 |
RRID: | AB_2844365 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10358, RRID:AB_2844365.
Fold/Unfold
5''-cyclic phosphodiesterase subunit gamma; CNRG_HUMAN; GMP-PDE gamma; MGC125749; PDE 6; PDE6G; PDEG; Phosphodiesterase 6G cGMP Specific; Phosphodiesterase 6G cGMP specific rog gamma; Retinal Rod Photoreceptor cGMP Phosphodiesterase gamma; Retinal rod rhodopsin sensitive cGMP 3' 5'vcyclic phosphodiesterase subunit gamma; Retinal rod rhodopsin-sensitive cGMP 3''; Rod cG PDE G; RP57;
Immunogens
- P18545 CNRG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P18545 As Substrate
Research Backgrounds
Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.
Oligomer composed of two catalytic chains (alpha and beta), an inhibitory chain (gamma) and the delta chain.
Belongs to the rod/cone cGMP-PDE gamma subunit family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Organismal Systems > Sensory system > Phototransduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.