Product: Phospho-Cyclin D3 (Thr283) Antibody
Catalog: AF3251
Description: Rabbit polyclonal antibody to Phospho-Cyclin D3 (Thr283)
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 31kDa(Observed); 33kD(Calculated).
Uniprot: P30281
RRID: AB_2834677

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
Phospho-Cyclin D3 (Thr283) Antibody detects endogenous levels of Cyclin D3 only when phosphorylated at Threonine 283.
RRID:
AB_2834677
Cite Format: Affinity Biosciences Cat# AF3251, RRID:AB_2834677.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CCND 3; Ccnd3; CCND3_HUMAN; CyclinD3; D3 type cyclin; G1 S specific cyclin D3; G1/S specific cyclin D3; G1/S-specific cyclin-D3;

Immunogens

Immunogen:

A synthesized peptide derived from human Cyclin D3 around the phosphorylation site of Thr283.

Uniprot:
Gene(ID):
Description:
CCND3 Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition.
Sequence:
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Chicken
100
Rabbit
100
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.

PTMs:

Polyubiquitinated by the SCF(FBXL2) complex, leading to proteasomal degradation.

Subcellular Location:

Nucleus. Cytoplasm. Membrane.
Note: Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated to the nucleus through interaction with KIP/CIP family members.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the cyclin family. Cyclin D subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > p53 signaling pathway.   (View pathway)

· Cellular Processes > Cell growth and death > Cellular senescence.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Wnt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

References

1). Mechanism of D-type cyclin recognition by the AMBRA1 E3 ligase receptor. Science advances, 2025 (PubMed: 40408472) [IF=11.7]

Application: WB    Species: human    Sample:

Fig. 5. AMBRA1 mediates the ubiquitination of D-type cyclins. (A) Ubiquitination assay of AMBRA1WD40 mediated the polyubiquitination of TSF–cyclin D1, T286A mutant, and C-terminal truncation. The experiment was repeated independently three times with similar results. (B) Ubiquitination assay of AMBRA1WD40 mediated the polyubiquitination of TSF–cyclin D2/cyclin D2T280A and TSF–cyclin D3/cyclin D3T283A. The experiment was repeated independently three times with similar results. (C) In vitro pull-down experiment of GST–cyclin D1 with MBP-AMBRA1FL-His and H75A/R96A/W99A mutant. The cells were cotransfected with GST–cyclin D1, CDK4EE-His6, His6-DDB1, and MBP-AMBRA1FL-His or MBP-AMBRA1H75A/R96A/W99A-His mutant. The experiment was repeated at least three times and visualized by Western blotting. (D) Ubiquitination assay of AMBRA1FL mediated the polyubiquitination of TSF–D-type cyclins and threonine phosphorylation site mutants. The experiment was repeated independently three times with similar results. (E) Ubiquitination assay of AMBRA1FL mediated the polyubiquitination of CDK4 was detected. The experiment was repeated independently three times with similar results. (F) Ubiquitination assay of AMBRA1FL mediated the polyubiquitination of GST–cyclin D1 C terminus, the hemagglutinin (HA)–ubiquitin, and K269R mutant as negative control. The experiment was repeated independently three times with similar results. (G) Ubiquitination assay of AMBRA1 mediated the polyubiquitination of GST–cyclin D1 C termini. Asterisk indicates the nonspecific band. The experiment was repeated independently three times with similar results. (H) Ubiquitination assay of AMBRA1WD40 WT and key binding site mutants mediated the polyubiquitination of cyclin D1. The results were analyzed by Western blotting. The experiment was repeated independently three times with similar results.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.