TXN Antibody - #AF7577
Product: | TXN Antibody |
Catalog: | AF7577 |
Description: | Rabbit polyclonal antibody to TXN |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 12kDa; 12kD(Calculated). |
Uniprot: | P10599 |
RRID: | AB_2843941 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7577, RRID:AB_2843941.
Fold/Unfold
ADF; ATL derived factor; ATL-derived factor; DKFZp686B1993; MGC61975; SASP; Surface associated sulphydryl protein; Surface-associated sulphydryl protein; testicular tissue protein Li 199; THIO_HUMAN; Thioredoxin; thioredoxin delta 3; TRDX; TRX 1; Trx; TRX1; TXN; TXN delta 3; TXN protein; zgc:92903;
Immunogens
- P10599 THIO_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P10599 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K3 | Acetylation | Uniprot | |
K3 | Ubiquitination | Uniprot | |
K8 | Acetylation | Uniprot | |
K8 | Methylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
T9 | Phosphorylation | Uniprot | |
T30 | Phosphorylation | Uniprot | |
K39 | Acetylation | Uniprot | |
K39 | Ubiquitination | Uniprot | |
S44 | Phosphorylation | Uniprot | |
S46 | Phosphorylation | Uniprot | |
K48 | Methylation | Uniprot | |
C62 | S-Nitrosylation | Uniprot | |
S67 | Phosphorylation | Uniprot | |
C69 | S-Nitrosylation | Uniprot | |
C73 | S-Nitrosylation | Uniprot | |
T76 | Phosphorylation | Uniprot | |
K81 | Acetylation | Uniprot | |
K85 | Ubiquitination | Uniprot | |
S90 | Phosphorylation | Uniprot | |
K94 | Acetylation | Uniprot | |
K94 | Ubiquitination | Uniprot | |
K96 | Ubiquitination | Uniprot | |
T100 | Phosphorylation | P17252 (PRKCA) | Uniprot |
Research Backgrounds
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
In the fully reduced protein, both Cys-69 and Cys-73 are nitrosylated in response to nitric oxide (NO). When two disulfide bonds are present in the protein, only Cys-73 is nitrosylated. Cys-73 can serve as donor for nitrosylation of target proteins.
In case of infection, ubiquitinated by S.typhimurium protein slrP, leading to its degradation.
Nucleus. Cytoplasm. Secreted.
Note: Translocates from the cytoplasm into the nucleus after phorbol 12-myristate 13-acetate induction (PMA) (PubMed:9108029). Predominantly in the cytoplasm in non irradiated cells (PubMed:11118054). Radiation induces translocation of TRX from the cytoplasm to the nucleus (PubMed:11118054). Secreted by a leaderless secretory pathway (PubMed:1332947).
Homodimer; disulfide-linked. Interacts with TXNIP through the redox-active site. Interacts with MAP3K5 and CASP3. In case of infection, interacts with S.typhimurium protein slrP. Interacts with APEX1; the interaction stimulates the FOS/JUN AP-1 DNA-binding activity in a redox-dependent manner.
Belongs to the thioredoxin family.
Research Fields
· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample: Min6 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.