HFE2 Antibody - #AF7556
Product: | HFE2 Antibody |
Catalog: | AF7556 |
Description: | Rabbit polyclonal antibody to HFE2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 45kDa; 45kD(Calculated). |
Uniprot: | Q6ZVN8 |
RRID: | AB_2843920 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7556, RRID:AB_2843920.
Fold/Unfold
2310035L15Rik; 5230400G09Rik; AI414844; AI789733; DL M; Haemojuvelin; HEMOCHROMATOSIS; HEMOCHROMATOSIS DUE TO DEFECT IN HEMOJUVELIN; HEMOCHROMATOSIS DUE TO DEFECT IN HEPCIDIN ANTIMICROBIAL PEPTIDE; HEMOCHROMATOSIS JUVENILE; Hemochromatosis type 2 (juvenile); Hemochromatosis type 2; Hemochromatosis type 2 protein; Hemochromatosis type 2 protein homolog; HEMOCHROMATOSIS, TYPE 2A; HEMOCHROMATOSIS, TYPE 2B; Hemojuvelin; HFE 2; Hfe2; HFE2A; HJV; JH; Juvenile; MGC23953; OTTHUMP00000059680; Repulsive guidance molecule c; RGM C; RGM domain family member C; RGMC;
Immunogens
- Q6ZVN8 RGMC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGEPGQSPSPRSSHGSPPTLSTLTLLLLLCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ
PTMs - Q6ZVN8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S7 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S48 | Phosphorylation | Uniprot | |
S49 | Phosphorylation | Uniprot | |
S52 | Phosphorylation | Uniprot | |
T290 | Phosphorylation | Uniprot |
Research Backgrounds
Acts as a bone morphogenetic protein (BMP) coreceptor. Through enhancement of BMP signaling regulates hepcidin (HAMP) expression and regulates iron homeostasis.
Autocatalytically cleaved at low pH; the two chains remain linked via two disulfide bonds. Also proteolytically processed by TMPRSS6, several fragments being released in the extracellular space; regulates HJV activity in BMP signaling and thefore iron homeostasis.
Cell membrane>Lipid-anchor.
Note: Also released in the extracellular space.
Adult and fetal liver, heart, and skeletal muscle.
Interacts with BMP2 and BMP4 (By similarity). Interacts with BMPR1B. Interacts with TMPRSS6.
Belongs to the repulsive guidance molecule (RGM) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.