SLC32A1 Antibody - #AF7551
Product: | SLC32A1 Antibody |
Catalog: | AF7551 |
Description: | Rabbit polyclonal antibody to SLC32A1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 57kDa; 57kD(Calculated). |
Uniprot: | Q9H598 |
RRID: | AB_2843915 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7551, RRID:AB_2843915.
Fold/Unfold
bA122O1.1; GABA and glycine transporter; hVIAAT; SLC32A 1; Slc32a1; solute carrier family 32 (GABA vesicular transporter) member 1; Solute carrier family 32 member 1; Vesicular GABA Amino Acid Transporter; Vesicular GABA transporter; Vesicular inhibitory amino acid transporter; VGAT; VIAAT; VIAAT_HUMAN;
Immunogens
Retina. Expressed throughout the horizontal cells or more specifically at the terminals.
- Q9H598 VIAAT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H598 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S17 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
S96 | Phosphorylation | Uniprot | |
S98 | Phosphorylation | Uniprot | |
Y300 | Phosphorylation | Uniprot | |
T443 | Phosphorylation | Uniprot | |
S462 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the uptake of GABA and glycine into the synaptic vesicles.
Cytoplasmic vesicle membrane>Multi-pass membrane protein.
Retina. Expressed throughout the horizontal cells or more specifically at the terminals.
Belongs to the amino acid/polyamine transporter 2 family.
Research Fields
· Human Diseases > Substance dependence > Morphine addiction.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
· Organismal Systems > Nervous system > GABAergic synapse.
References
Application: WB Species: rat Sample: PC12 cell
Application: IF/ICC Species: rat Sample: PC12 cell
Application: IHC Species: human Sample: ganglionic, transitional, and aganglionic colonic segments
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.