Phospho-NT5C (Ser184) Antibody - #AF7422
Product: | Phospho-NT5C (Ser184) Antibody |
Catalog: | AF7422 |
Description: | Rabbit polyclonal antibody to Phospho-NT5C (Ser184) |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 23kDa; 23kD(Calculated). |
Uniprot: | Q8TCD5 |
RRID: | AB_2843862 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7422, RRID:AB_2843862.
Fold/Unfold
3''-pyrimidine nucleotidase; 5' nucleotidase, deoxy (pyrimidine); 5' nucleotidase, deoxy (pyrimidine), cytosolic type C; 5''(3'')-deoxyribonucleotidase; 5'(3')-deoxyribonucleotidase, cytosolic type; 5', 3'-nucleotidase, cytosolic; 5-prime,3-prime-nucleotidase, cytosolic; cdN; Cytosolic 5''; cytosolic 5',3'-pyrimidine nucleotidase; cytosolic type; cytosolic type C,5',3'-nucleotidase; cytosolic,uridine 5'-monophosphate phosphohydrolase 2; Deoxy 5' nucleotidase 1; Deoxy-5''-nucleotidase 1; Deoxyribonucleotidase, cytosolic, 1; DNT; dNT-1; dNT1; Nt5c; NT5C_HUMAN; P5N2; PN-I; PN-II; Pyrimidine 5-prime nucleotidase 2; UMPH2; uridine 5'-monophosphate phosphohydrolase 2; uridine 5-prime monophosphate hydrolase 2;
Immunogens
A synthesized peptide derived from human NT5C around the phosphorylation site of Ser184.
- Q8TCD5 NT5C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
Cytoplasm.
Detected in skeletal muscle, heart and pancreas.
Belongs to the 5'(3')-deoxyribonucleotidase family.
Research Fields
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.