Phospho-Peroxiredoxin 1 (Ser196) Antibody - #AF7358
Product: | Phospho-Peroxiredoxin 1 (Ser196) Antibody |
Catalog: | AF7358 |
Description: | Rabbit polyclonal antibody to Phospho-Peroxiredoxin 1 (Ser196) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 22kDa; 22kD(Calculated). |
Uniprot: | Q06830 |
RRID: | AB_2843798 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7358, RRID:AB_2843798.
Fold/Unfold
Heme binding 23 kDa protein; MSP23; Natural killer cell-enhancing factor A; NKEF A; NKEF-A; NKEFA; OSF3; Osteoblast specific factor 3; PAG; Paga; PAGB; Peroxiredoxin-1; PRDX1; PRDX1_HUMAN; Proliferation associated gene A; Proliferation-associated gene protein; PRX1; PrxI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2;
Immunogens
- Q06830 PRDX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q06830 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Acetylation | Uniprot | |
K7 | Acetylation | Uniprot | |
K7 | Sumoylation | Uniprot | |
K7 | Ubiquitination | Uniprot | |
K16 | Acetylation | Uniprot | |
K16 | Methylation | Uniprot | |
K16 | Sumoylation | Uniprot | |
K16 | Ubiquitination | Uniprot | |
T18 | Phosphorylation | Q13043 (STK4) | Uniprot |
K27 | Acetylation | Uniprot | |
K27 | Methylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
S30 | Phosphorylation | Uniprot | |
S32 | Phosphorylation | Q96KB5 (PBK) | Uniprot |
Y34 | Phosphorylation | Uniprot | |
K35 | Acetylation | Uniprot | |
K35 | Ubiquitination | Uniprot | |
K37 | Acetylation | Uniprot | |
K37 | Ubiquitination | Uniprot | |
C52 | S-Nitrosylation | Uniprot | |
K67 | Acetylation | Uniprot | |
K67 | Sumoylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
S77 | Phosphorylation | Uniprot | |
S80 | Phosphorylation | Uniprot | |
T90 | Phosphorylation | P24941 (CDK2) , Q00534 (CDK6) , P06493 (CDK1) , P11802 (CDK4) , Q13043 (STK4) | Uniprot |
K92 | Acetylation | Uniprot | |
K93 | Acetylation | Uniprot | |
K93 | Sumoylation | Uniprot | |
K93 | Ubiquitination | Uniprot | |
S106 | Phosphorylation | Uniprot | |
K109 | Acetylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
T111 | Phosphorylation | Uniprot | |
Y116 | Phosphorylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
S126 | Phosphorylation | Uniprot | |
K136 | Acetylation | Uniprot | |
K136 | Ubiquitination | Uniprot | |
T143 | Phosphorylation | Uniprot | |
R151 | Methylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
T156 | Phosphorylation | Uniprot | |
R158 | Methylation | Uniprot | |
T166 | Phosphorylation | Uniprot | |
K168 | Acetylation | Uniprot | |
K168 | Ubiquitination | Uniprot | |
C173 | S-Nitrosylation | Uniprot | |
K178 | Acetylation | Uniprot | |
K178 | Methylation | Uniprot | |
K178 | Ubiquitination | Uniprot | |
S181 | Phosphorylation | Uniprot | |
T183 | Phosphorylation | Q13043 (STK4) | Uniprot |
K185 | Acetylation | Uniprot | |
K185 | Sumoylation | Uniprot | |
K185 | Ubiquitination | Uniprot | |
K190 | Ubiquitination | Uniprot | |
K192 | Sumoylation | Uniprot | |
K192 | Ubiquitination | Uniprot | |
Y194 | Phosphorylation | P06239 (LCK) | Uniprot |
S196 | Phosphorylation | Uniprot | |
K197 | Acetylation | Uniprot | |
K197 | Ubiquitination | Uniprot |
Research Backgrounds
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity.
The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.
Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Homodimer; disulfide-linked, upon oxidation. 5 homodimers assemble to form a ring-like decamer. Interacts with GDPD5; forms a mixed-disulfide with GDPD5 (By similarity). Interacts with SESN1 and SESN2. Interacts with FAM107A.
Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.
Research Fields
· Cellular Processes > Transport and catabolism > Peroxisome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.