Product: Phospho-YB1 (Ser176) Antibody
Catalog: AF7332
Description: Rabbit polyclonal antibody to Phospho-YB1 (Ser176)
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 50kDa; 36kD(Calculated).
Uniprot: P67809
RRID: AB_2843772

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(89%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
Phospho-YB1 (Ser176) Antibody detects endogenous levels of YB1 only when phosphorylated at Ser176.
RRID:
AB_2843772
Cite Format: Affinity Biosciences Cat# AF7332, RRID:AB_2843772.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BP 8; CBF-A; CCAAT binding transcription factor I subunit A; CCAAT-binding transcription factor I subunit A; CSDA2; CSDB; DBPB; DNA binding protein B; DNA-binding protein B; EFI-A; Enhancer factor I subunit A; MDR NF1; MGC104858; MGC110976; MGC117250; NSEP 1; NSEP1; Nuclease sensitive element binding protein 1; Nuclease-sensitive element-binding protein 1; p50; Q15905; Y-box binding protein 1; Y-box transcription factor; Y-box-binding protein 1; YB 1; YB-1; YBOX1_HUMAN; YBX 1; ybx1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Zebrafish
89
Xenopus
78
Chicken
67
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P67809 As Substrate

Site PTM Type Enzyme
S2 Acetylation
S2 Phosphorylation
S3 Phosphorylation
T7 Phosphorylation
S21 Phosphorylation
K26 Ubiquitination
S32 Phosphorylation
S36 Phosphorylation
S44 Phosphorylation
K52 Ubiquitination
K58 Ubiquitination
K64 Acetylation
K64 Ubiquitination
Y72 Phosphorylation
T80 Phosphorylation O14757 (CHEK1)
K81 Acetylation
K81 Ubiquitination
T89 Phosphorylation
K92 Ubiquitination
K93 Ubiquitination
Y99 Phosphorylation
R101 Methylation
S102 Phosphorylation P51812 (RPS6KA3) , Q15418 (RPS6KA1) , P31749 (AKT1)
T108 Phosphorylation
K118 Ubiquitination
S136 Phosphorylation
K137 Acetylation
K137 Ubiquitination
R142 Methylation
Y145 Phosphorylation
Y158 Phosphorylation
Y162 Phosphorylation
S165 Phosphorylation
S167 Phosphorylation
K170 Ubiquitination
S174 Phosphorylation
S176 Phosphorylation
R185 Methylation
R186 Methylation
Y188 Phosphorylation
R189 Methylation
R190 Methylation
Y196 Phosphorylation
Y197 Phosphorylation
R199 Methylation
R200 Methylation
R204 Methylation
R205 Methylation
Y208 Phosphorylation
S209 Phosphorylation
R231 Methylation
R234 Methylation
Y238 Phosphorylation
R239 Methylation
R242 Methylation
R244 Methylation
K264 Ubiquitination
T271 Phosphorylation
R279 Methylation
R280 Methylation
Y281 Phosphorylation
Y287 Phosphorylation
K296 Ubiquitination
K301 Acetylation
K301 Ubiquitination
K304 Acetylation
K304 Ubiquitination
S313 Phosphorylation
S314 Phosphorylation

Research Backgrounds

Function:

DNA- and RNA-binding protein involved in various processes, such as translational repression, RNA stabilization, mRNA splicing, DNA repair and transcription regulation. Predominantly acts as a RNA-binding protein: binds preferentially to the 5'-[CU]CUGCG-3' RNA motif and specifically recognizes mRNA transcripts modified by C5-methylcytosine (m5C). Promotes mRNA stabilization: acts by binding to m5C-containing mRNAs and recruiting the mRNA stability maintainer ELAVL1, thereby preventing mRNA decay. Component of the CRD-mediated complex that promotes MYC mRNA stability. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity). Plays a key role in RNA composition of extracellular exosomes by defining the sorting of small non-coding RNAs, such as tRNAs, Y RNAs, Vault RNAs and miRNAs. Probably sorts RNAs in exosomes by recognizing and binding C5-methylcytosine (m5C)-containing RNAs. Acts as a key effector of epidermal progenitors by preventing epidermal progenitor senescence: acts by regulating the translation of a senescence-associated subset of cytokine mRNAs, possibly by binding to m5C-containing mRNAs. Also involved in pre-mRNA alternative splicing regulation: binds to splice sites in pre-mRNA and regulates splice site selection. Also able to bind DNA: regulates transcription of the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as MDR1 and HLA class II genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA, suggesting a role in DNA repair. The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.

PTMs:

Ubiquitinated by RBBP6; leading to a decrease of YBX1 transcactivational ability.

In the absence of phosphorylation the protein is retained in the cytoplasm.

Cleaved by a 20S proteasomal protease in response to agents that damage DNA. Cleavage takes place in the absence of ubiquitination and ATP. The resulting N-terminal fragment accumulates in the nucleus (By similarity).

Subcellular Location:

Cytoplasm. Nucleus. Cytoplasmic granule. Secreted. Secreted>Extracellular exosome.
Note: Predominantly cytoplasmic in proliferating cells (PubMed:12604611). Cytotoxic stress and DNA damage enhance translocation to the nucleus (PubMed:14718551). Localized in cytoplasmic mRNP granules containing untranslated mRNAs (PubMed:25229427). Shuttles between nucleus and cytoplasm (PubMed:25229427). Localized with DDX1, MBNL1 and TIAL1 in stress granules upon stress (PubMed:18335541). Secreted by mesangial and monocytic cells after inflammatory challenges (PubMed:19483673).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Homodimer in the presence of ATP. Component of the coding region determinant (CRD)-mediated complex, composed of DHX9, HNRNPU, IGF2BP1, SYNCRIP and YBX1. Identified in a IGF2BP1-dependent mRNP granule complex containing untranslated mRNAs. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Identified in a histone pre-mRNA complex, at least composed of ERI1, LSM11, SLBP, SNRPB, SYNCRIP and YBX1 (By similarity). Interacts with IGF2BP1 and RBBP6. Component of cytoplasmic messenger ribonucleoprotein particles (mRNPs). Interacts with AKT1, MBNL1, SFRS9, SFRS12, ALYREF/THOC4, MSH2, XRCC5, WRN and NCL. Interacts (via C-terminus) with APEX1 (via N-terminus); the interaction is increased with APEX1 acetylated at 'Lys-6' and 'Lys-7'. Interacts with AGO1 and AGO2. Interacts with ANKRD2. Interacts with DERA. Interacts with FMR1; this interaction occurs in association with polyribosome (By similarity). Interacts with ZBTB7B (By similarity). Interacts with HDGF (isoform 1). Interacts with ELAVL1; leading to ELAVL1 recruitment on C5-methylcytosine (m5C)-containing mRNAs and subsequent mRNA stability.

Family&Domains:

In the CSD domain, Trp-65 specifically recognizes C5-methylcytosine (m5C) modification through its indole ring.

Belongs to the YBX1 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.