Phospho-EIF2S2 (Tyr298) Antibody - #AF7255
Product: | Phospho-EIF2S2 (Tyr298) Antibody |
Catalog: | AF7255 |
Description: | Rabbit polyclonal antibody to Phospho-EIF2S2 (Tyr298) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 40KD; 38kD(Calculated). |
Uniprot: | P20042 |
RRID: | AB_2843695 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7255, RRID:AB_2843695.
Fold/Unfold
DKFZp686L18198; eIF 2 beta; eIF-2-beta; EIF2; EIF2B; EIF2beta; EIF2S2; Eukaryotic initiation factor 2 beta; eukaryotic initiation factor 2-beta; Eukaryotic translation initiation factor 2 beta; Eukaryotic translation initiation factor 2 subunit 2; Eukaryotic translation initiation factor 2 subunit 2 beta 38kDa; Eukaryotic translation initiation factor 2 subunit 2 beta; Eukaryotic translation initiation factor 2 subunit beta; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; IF2B_HUMAN; MGC8508; PPP1R67; protein phosphatase 1, regulatory subunit 67;
Immunogens
- P20042 IF2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P20042 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
S2 | Acetylation | Uniprot | |
S2 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
T11 | Phosphorylation | Uniprot | |
S13 | Phosphorylation | Uniprot | |
T31 | Phosphorylation | Uniprot | |
T33 | Phosphorylation | Uniprot | |
T36 | Phosphorylation | Uniprot | |
S39 | Phosphorylation | Uniprot | |
K52 | Ubiquitination | Uniprot | |
K64 | Ubiquitination | Uniprot | |
S67 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
K79 | Ubiquitination | Uniprot | |
K87 | Ubiquitination | Uniprot | |
K99 | Ubiquitination | Uniprot | |
S105 | Phosphorylation | Uniprot | |
T111 | Phosphorylation | Uniprot | |
K124 | Methylation | Uniprot | |
K124 | Ubiquitination | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K132 | Ubiquitination | Uniprot | |
K142 | Ubiquitination | Uniprot | |
K153 | Ubiquitination | Uniprot | |
S158 | Phosphorylation | Uniprot | |
R172 | Methylation | Uniprot | |
T175 | Phosphorylation | Uniprot | |
Y176 | Phosphorylation | Uniprot | |
K190 | Acetylation | Uniprot | |
K190 | Ubiquitination | Uniprot | |
K199 | Ubiquitination | Uniprot | |
K205 | Ubiquitination | Uniprot | |
K216 | Ubiquitination | Uniprot | |
S218 | Phosphorylation | P17612 (PRKACA) | Uniprot |
C226 | S-Nitrosylation | Uniprot | |
K227 | Acetylation | Uniprot | |
K227 | Ubiquitination | Uniprot | |
K265 | Acetylation | Uniprot | |
K265 | Ubiquitination | Uniprot | |
K276 | Acetylation | Uniprot | |
K276 | Ubiquitination | Uniprot | |
Y278 | Phosphorylation | Uniprot | |
T283 | Phosphorylation | Uniprot | |
S286 | Phosphorylation | Uniprot | |
K293 | Acetylation | Uniprot | |
K293 | Ubiquitination | Uniprot | |
R296 | Methylation | Uniprot | |
Y298 | Phosphorylation | Uniprot | |
S310 | Phosphorylation | Uniprot | |
K315 | Ubiquitination | Uniprot | |
K324 | Acetylation | Uniprot | |
K324 | Ubiquitination | Uniprot |
Research Backgrounds
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
Heterotrimer composed of an alpha, a beta and a gamma chain. Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5 (By similarity).
Belongs to the eIF-2-beta/eIF-5 family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.